T'Bird updates for 115 ... are they problem free now

3 months ago I was on version 115.3.1 and asked a question about the safety of 115 updates. I received the following answer from sfhowes: If you're already on 115, you sh… (read more)

3 months ago I was on version 115.3.1 and asked a question about the safety of 115 updates. I received the following answer from sfhowes: If you're already on 115, you shouldn't have any issues with further updates to the 115 branch, as some, but not all, problems are fixed with each 115 release. The time to hesitate is when the annual major release is offered around June/July. Wait a few months for the major bugs to be fixed, or run two versions side-by-side.

I continued to update to further 115 releases but, because of the many apparent user issues, I stopped updating at version 115.5.1. The latest release is now 115.8.0. Can anyone guarantee 'no issues' if I now permit this release to be installed ... I have no problems using 115.5.1 but perhaps this is now a security risk?

Asked by RonSH 32 minutes ago

Thunderbird will not connect to comcast imap

v115.7.0 I have been a user and contributor for years. OS is still Win7. I have had a IMAP connection to Comcast for years, now it will not connect. I have made sure … (read more)

v115.7.0 I have been a user and contributor for years. OS is still Win7. I have had a IMAP connection to Comcast for years, now it will not connect. I have made sure I am using the correct password. When I start thunderbird, a secondary window pops up with the error message unable to connect. WEnt thru lots of posts but no results. One interesting said to disable IPV6 security option, but the way they described the fix was to access thry the EDIT menu then Preferences, but my system does not have Preferences under Edit.

Rich Dolan Richard.dolan@gmail.com

Asked by Rich Dolan 6 hours ago

Error Msg when opening link in email. Breakdown in Thunderbird and search engine

I find that when I click on links to take me to website through my email in Thunderbird that I will get an error message that reads "we could not verify the certificate, … (read more)

I find that when I click on links to take me to website through my email in Thunderbird that I will get an error message that reads "we could not verify the certificate, reason=wronghost"

But, if I copy link and copy into browser it works fine. There is a break in the Thunderbird email to the browser. This does not happen with all links but there are about three or four that I get regularly where it fails.

I have talked to a tech guy and we have tried different things and it always comes back to a break in Thunderbird email.

How do I fix this problem?

Thank you, Monica

Asked by mmikkola914 10 hours ago

composition and display in Thunderbird

Microsoft Outlook composition is close to that of Microsoft Word. Shouldn't Thunderbird do the SAME? People WRITE in their mail clients with a subset of the abilities in… (read more)

Microsoft Outlook composition is close to that of Microsoft Word. Shouldn't Thunderbird do the SAME?

People WRITE in their mail clients with a subset of the abilities in a full word processor. THIS is certainly an attraction OF Microsoft (though I hate to even TYPE the word!).

My thought is that INTEGRATION with a subset of LibreOffice would be IDEAL for Thunderbird.

For me, the lack of WORD WRAP is a constant irritation.

Of course, one can compose in LO and SAVE to PDF and ATTACH the result, but this is ungainly for ordinary communications.

My FAVORITE wordprocessor ever was the earlier WordPerfect that could display (and EDIT) ALL CONTROL CODES in the text (MUCH easier - and FAR less TYPING - than trying to learn HTML!).

I have been thinking of the LibreOffice integration for YEARS - ever since I began to USE LO (which, like Thunderbird, I send support to!)

THIS entry box HAS word wrap - WHY not Thunderbird?????? Don't any Thunderbird DEVELOPERS ever - WRITE?

It is being recognized that handwriting benefits the BRAIN - I suppose we may actually need to go back there again...

I abandoned MS for Linux then gave up on Linux for MacOS, because hardware vendors don't support their products fully under Linux (like Dymo address label software). And, of course, MacOS IS genuine UNIX, thanks to Steve Jobs!

Asked by Paul Hubert 9 hours ago

getting messages from pop server

1.Running Thunderbird 115.6.0 64 bit on Windows 10. 2.Using Microsoft Defender as AntiVirus and I set Thunderbird profile folder to be excluded from AV. 3.Getting emails … (read more)

1.Running Thunderbird 115.6.0 64 bit on Windows 10. 2.Using Microsoft Defender as AntiVirus and I set Thunderbird profile folder to be excluded from AV. 3.Getting emails from a single Earthlink pop server account. Problem: When clicking Get Messages it works great except yesterday there was one single email on the pop server that would not download properly. It prevented all subsequent messages from downloading. It is a valid email and is not spam. When I searched for the message, it showed multiple times (about 50) in the Thunderbird Inbox. When I deleted the email from the pop server, everything works again. What is there about this messages that causes it to lockup the get message process? Thanks for your help, John

Here is the problem email header: Authentication-Results:mail142c38.carrierzone.com; spf=pass smtp.mailfrom=bankhometown.com Content-Transfer-Encoding:8bit Content-Type:text/plain; charset=us-ascii Date:16 Feb 2024 23:37:56 -0500 Dmarc-Filter:OpenDMARC Filter v1.4.1 mail142c38.carrierzone.com 41H4bxPb013175 From:PPDONOTREPLY@bankhometown.com Message-ID:<3w65bxfyau-1@ppt-gw2.cocci.com> Mime-Version:1.0 Received:from ext-smtp.cocci.com (mail-ext01.cocci.com [204.60.84.37]) by mail142c38.carrierzone.com (8.14.9/8.13.1) with ESMTP id 41H4bxPb013175 for <lisa@bcscompany.com>; Fri, 16 Feb 2024 23:38:02 -0500 Received-Spf:pass (mail142c38.carrierzone.com: domain of ppdonotreply@bankhometown.com designates 204.60.84.37 as permitted sender) receiver=mail142c38.carrierzone.com; client-ip=204.60.84.37; helo=ext-smtp.cocci.com; envelope-from=ppdonotreply@bankhometown.com; x-software=spfmilter 2.001 http://www.acme.com/software/spfmilter/ with libspf2-1.2.10; Return-Path:<ppdonotreply@bankhometown.com> Subject:Positive Pay System Notifications To:lisa@bcscompany.com X-Cocc-Mailscanner:Not scanned: please contact your Internet E-Mail Service Provider for details X-Cocc-Mailscanner-Information:Please contact the ISP for more information X-Cocc-Msgid:DB8A556B4.A1271 X-Da-Pass:W0T0 X-Envelope-From:ppdonotreply@bankhometown.com X-Mime-Autoconverted:from quoted-printable to 8bit by mail142c38.carrierzone.com id 41H4bxPb013175 X-Origin-Country:US X-Spam-Flag:NO X-Vade-Spamcause:gggruggvucftvghtrhhoucdtuddrgedvledrvdefgdejvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffuvffqrffktedpgffpggdqveefkeenuceurghilhhouhhtmecufedtudenucenucfjughrpegghffvfffutgfgkfesthhqredttddtvdenucfhrhhomheprffrfffqpffqvfftgffrnfgjsegsrghnkhhhohhmvghtohifnhdrtghomhenucggtffrrghtthgvrhhnpeekjeehieetvefftedvheekhedvudetffeufeehveejjeetvdfhteegffevleduudenucfkphepvddtgedriedtrdekgedrfeejnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtgedriedtrdekgedrfeejpdhhvghlohepvgigthdqshhmthhprdgtohgttghirdgtohhmpdhmrghilhhfrhhomhepphhpughonhhothhrvghplhihsegsrghnkhhhohhmvghtohifnhdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehlihhsrgessggtshgtohhmphgrnhihrdgtohhm X-Vade-Spamscore:0 X-Vade-Spamstate:clean X-Whl:LR

Asked by john395 19 hours ago

emails not coming through

as from the 19/2 the emails are not coming through also It would not send emails if you can help you can email me back on thevrons@hotmail.com.Thankyou Ron Turner … (read more)

as from the 19/2 the emails are not coming through also It would not send emails if you can help you can email me back on thevrons@hotmail.com.Thankyou Ron Turner

Asked by Ron Turner 8 hours ago

TB: 2 differents e-mails account behaviours with the same imap.orange.fr server

Hello Mozilla Thunderbird forum, I have a Thunderbird latest release installation that fetches mails in 2 different ways with the same imap.orange.fr server and settings… (read more)

Hello Mozilla Thunderbird forum, I have a Thunderbird latest release installation that fetches mails in 2 different ways with the same imap.orange.fr server and settings. The 1st account works as pop protocol: that means that messages are loaded locally, deleted from the server ; and no mail subfolders are present in the Thunderbird interface. The 2nd account synchronizes the mails and all remote subfolders in the local interface. To me, the 1st account is working weirdly. But I can't understand the reason of that. Have you some idea about that? with the best regards, Bernard (from France, sorry for the bad language ;-))

Asked by Bernye00 55 minutes ago

Different email load same folders and messages

I am setting up Thunderbird on a new computer. I have installed the most recent version of TB. I have different att/yahoo emails that are separate att/yahoo accounts an… (read more)

I am setting up Thunderbird on a new computer. I have installed the most recent version of TB. I have different att/yahoo emails that are separate att/yahoo accounts and not linked. When I set up the first account, it downloads all folders and emails perfectly. However, when I set up the next account, it will only download the same folders/emails from the first account. They are both set up as IMAP with unique usernames and passwords. I had the same issue when I transferred the TB profile from the old computer. I have no issues with different google email accounts. I have uninstalled TB and deleted all folders with no change when setting it up again. I have cleared all cookies on all browsers and closed them. Any solutions?

Asked by Bon Jovi 5 days ago

Error collecting mail on some accounts

When I attempt to retrieve mail (from some accounts) I receive the error message "account being processed, please wait until completion to download the messages" (see att… (read more)

When I attempt to retrieve mail (from some accounts) I receive the error message "account being processed, please wait until completion to download the messages" (see att.). Even after a long time (hours) the same happens - so I have to use my phone or IMAPS to get my messages. This happens only since I upgraded to Supernova (currently 115.7.0) and apparently on mail server orange.fr (but not all my mail accounts on orange.fr). I did not change (manually) any setting. Other mail servers (including wanadoo.fr which is an orange.fr mail server) seem to work ok. Thanks for any help & BR Max.

Asked by max.wach 17 hours ago

Why did all of my inbox messages disappear?

Suddenly all of the hundreds of messages in my inbox have disappeared. Even newer messages appear briefly and then disappear. They are not in my Trash file or archived. T… (read more)

Suddenly all of the hundreds of messages in my inbox have disappeared. Even newer messages appear briefly and then disappear. They are not in my Trash file or archived. They are just gone. This is a disaster, as several of the messages were needing to be responded to.


 Application Basics
   Name: Thunderbird
   Version: 115.7.0
   Build ID: 20240119095007
   Distribution ID:
   Update Channel: release
   User Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:115.0) Gecko/20100101 Thunderbird/115.7.0
   OS: Windows_NT 10.0 22621
   OS Theme:
   Launcher Process: Enabled
   Multiprocess Windows: 0/0
   Fission Windows: 0/0
             Enabled by default
   Remote Processes: 0
   Enterprise Policies: Inactive
   Google Location Service Key: Missing
   Google Safebrowsing Key: Missing
   Mozilla Location Service Key: Missing
   Safe Mode: true
   Memory Size (RAM): 15.7 GB
   Disk Space Available: 297 GB
 Mail and News Accounts
   account1:
     INCOMING: account1, , (imap) mail.rlhowser.com:993, SSL, passwordCleartext
     OUTGOING: , mail.rlhowser.com:465, SSL, passwordCleartext, true
   account2:
     INCOMING: account2, , (none) Local Folders, 0, passwordCleartext
   account4:
     INCOMING: account4, , (pop3) pop.asahi-net.or.jp:995, SSL, passwordCleartext
     OUTGOING: , mail.asahi-net.or.jp:465, SSL, passwordCleartext, true
 Libraries
     Library
     Status
     Expected minimum version
     Version in use
     Path
     RNP (OpenPGP)
 Calendar Settings
   Home
     Name
     Value
     Name:
     Type: storage
     Disabled: true
     Username:
     URI:
     Refresh Interval:
     Read-only:
     Suppress Alarms:
     Cache Enabled:
     iMIP Identity: id1
     iMIP Disabled:
     iMIP Account:
     Organizer Id:
     Force Email Scheduling:
     Popup Alarms Supported:
     Alarms on Invitation Supported:
     Max Alarms Per Event:
     Attachment Supported:
     Max Categories:
     Privacy State Supported:
     Priority Supported: true
     Event Supported:
     Task Supported:
     Local Time Supported:
     UTC/GMT Supported:
     Auto-Scheduling Supported:
 Crash Reports for the Last 3 Days
 Remote Processes
   Type: Count
 Add-ons
     Name
     Type
     Version
     Enabled
     ID
       Amazon.com
       extension
       1.1
       true
       amazondotcom@search.mozilla.org
       Bing
       extension
       1.0
       true
       bing@search.mozilla.org
       DuckDuckGo
       extension
       1.0
       true
       ddg@search.mozilla.org
       Google
       extension
       1.0
       true
       google@search.mozilla.org
       Wikipedia (en)
       extension
       1.0
       true
       wikipedia@search.mozilla.org
 Security Software
   Type: Name
     Antivirus: AVG Antivirus
     Antispyware:
     Firewall: Windows Firewall
 Graphics
     Features
     Compositing: WebRender (Software)
     Asynchronous Pan/Zoom: wheel input enabled; scrollbar drag enabled; keyboard enabled; autoscroll enabled; smooth pinch-zoom enabled
     WebGL 1 Driver WSI Info: -
     WebGL 1 Driver Renderer: WebGL is currently disabled.
     WebGL 1 Driver Version: -
     WebGL 1 Driver Extensions: -
     WebGL 1 Extensions: -
     WebGL 2 Driver WSI Info: -
     WebGL 2 Driver Renderer: WebGL is currently disabled.
     WebGL 2 Driver Version: -
     WebGL 2 Driver Extensions: -
     WebGL 2 Extensions: -
     Target Frame Rate: 59
     DirectWrite: true (10.0.22621.3085)
     GPU #1
     Active: Yes
     Description: NVIDIA GeForce RTX 3060
     Vendor ID: 0x10de
     Device ID: 0x2504
     Driver Version: 31.0.15.4633
     Driver Date: 12-6-2023
     Drivers: C:\WINDOWS\System32\DriverStore\FileRepository\nvddi.inf_amd64_eeb78e7fd073f332\nvldumdx.dll,C:\WINDOWS\System32\DriverStore\FileRepository\nvddi.inf_amd64_eeb78e7fd073f332\nvldumdx.dll,C:\WINDOWS\System32\DriverStore\FileRepository\nvddi.inf_amd64_eeb78e7fd073f332\nvldumdx.dll,C:\WINDOWS\System32\DriverStore\FileRepository\nvddi.inf_amd64_eeb78e7fd073f332\nvldumdx.dll C:\WINDOWS\System32\DriverStore\FileRepository\nvddi.inf_amd64_eeb78e7fd073f332\nvldumd.dll,C:\WINDOWS\System32\DriverStore\FileRepository\nvddi.inf_amd64_eeb78e7fd073f332\nvldumd.dll,C:\WINDOWS\System32\DriverStore\FileRepository\nvddi.inf_amd64_eeb78e7fd073f332\nvldumd.dll,C:\WINDOWS\System32\DriverStore\FileRepository\nvddi.inf_amd64_eeb78e7fd073f332\nvldumd.dll
     Subsys ID: 00000000
     RAM: 12288
     GPU #2
     Active: No
     RAM: 0
     Diagnostics
     AzureCanvasBackend: skia
     AzureContentBackend: skia
     AzureFallbackCanvasBackend: skia
     CMSOutputProfile: AAAMSExpbm8CEAAAbW50clJHQiBYWVogB84AAgAJAAYAMQAAYWNzcE1TRlQAAAAASUVDIHNSR0IAAAAAAAAAAAAAAAAAAPbWAAEAAAAA0y1IUCAgAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAARY3BydAAAAVAAAAAzZGVzYwAAAYQAAABsd3RwdAAAAfAAAAAUYmtwdAAAAgQAAAAUclhZWgAAAhgAAAAUZ1hZWgAAAiwAAAAUYlhZWgAAAkAAAAAUZG1uZAAAAlQAAABwZG1kZAAAAsQAAACIdnVlZAAAA0wAAACGdmlldwAAA9QAAAAkbHVtaQAAA/gAAAAUbWVhcwAABAwAAAAkdGVjaAAABDAAAAAMclRSQwAABDwAAAgMZ1RSQwAABDwAAAgMYlRSQwAABDwAAAgMdGV4dAAAAABDb3B5cmlnaHQgKGMpIDE5OTggSGV3bGV0dC1QYWNrYXJkIENvbXBhbnkAAGRlc2MAAAAAAAAAEnNSR0IgSUVDNjE5NjYtMi4xAAAAAAAAAAAAAAASc1JHQiBJRUM2MTk2Ni0yLjEAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAFhZWiAAAAAAAADzUQABAAAAARbMWFlaIAAAAAAAAAAAAAAAAAAAAABYWVogAAAAAAAAb6IAADj1AAADkFhZWiAAAAAAAABimQAAt4UAABjaWFlaIAAAAAAAACSgAAAPhAAAts9kZXNjAAAAAAAAABZJRUMgaHR0cDovL3d3dy5pZWMuY2gAAAAAAAAAAAAAABZJRUMgaHR0cDovL3d3dy5pZWMuY2gAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAZGVzYwAAAAAAAAAuSUVDIDYxOTY2LTIuMSBEZWZhdWx0IFJHQiBjb2xvdXIgc3BhY2UgLSBzUkdCAAAAAAAAAAAAAAAuSUVDIDYxOTY2LTIuMSBEZWZhdWx0IFJHQiBjb2xvdXIgc3BhY2UgLSBzUkdCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGRlc2MAAAAAAAAALFJlZmVyZW5jZSBWaWV3aW5nIENvbmRpdGlvbiBpbiBJRUM2MTk2Ni0yLjEAAAAAAAAAAAAAACxSZWZlcmVuY2UgVmlld2luZyBDb25kaXRpb24gaW4gSUVDNjE5NjYtMi4xAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAB2aWV3AAAAAAATpP4AFF8uABDPFAAD7cwABBMLAANcngAAAAFYWVogAAAAAABMCVYAUAAAAFcf521lYXMAAAAAAAAAAQAAAAAAAAAAAAAAAAAAAAAAAAKPAAAAAnNpZyAAAAAAQ1JUIGN1cnYAAAAAAAAEAAAAAAUACgAPABQAGQAeACMAKAAtADIANwA7AEAARQBKAE8AVABZAF4AYwBoAG0AcgB3AHwAgQCGAIsAkACVAJoAnwCkAKkArgCyALcAvADBAMYAywDQANUA2wDgAOUA6wDwAPYA+wEBAQcBDQETARkBHwElASsBMgE4AT4BRQFMAVIBWQFgAWcBbgF1AXwBgwGLAZIBmgGhAakBsQG5AcEByQHRAdkB4QHpAfIB+gIDAgwCFAIdAiYCLwI4AkECSwJUAl0CZwJxAnoChAKOApgCogKsArYCwQLLAtUC4ALrAvUDAAMLAxYDIQMtAzgDQwNPA1oDZgNyA34DigOWA6IDrgO6A8cD0wPgA+wD+QQGBBMEIAQtBDsESARVBGMEcQR+BIwEmgSoBLYExATTBOEE8AT+BQ0FHAUrBToFSQVYBWcFdwWGBZYFpgW1BcUF1QXlBfYGBgYWBicGNwZIBlkGagZ7BowGnQavBsAG0QbjBvUHBwcZBysHPQdPB2EHdAeGB5kHrAe/B9IH5Qf4CAsIHwgyCEYIWghuCIIIlgiqCL4I0gjnCPsJEAklCToJTwlkCXkJjwmkCboJzwnlCfsKEQonCj0KVApqCoEKmAquCsUK3ArzCwsLIgs5C1ELaQuAC5gLsAvIC+EL+QwSDCoMQwxcDHUMjgynDMAM2QzzDQ0NJg1ADVoNdA2ODakNww3eDfgOEw4uDkkOZA5/DpsOtg7SDu4PCQ8lD0EPXg96D5YPsw/PD+wQCRAmEEMQYRB+EJsQuRDXEPURExExEU8RbRGMEaoRyRHoEgcSJhJFEmQShBKjEsMS4xMDEyMTQxNjE4MTpBPFE+UUBhQnFEkUahSLFK0UzhTwFRIVNBVWFXgVmxW9FeAWAxYmFkkWbBaPFrIW1hb6Fx0XQRdlF4kXrhfSF/cYGxhAGGUYihivGNUY+hkgGUUZaxmRGbcZ3RoEGioaURp3Gp4axRrsGxQbOxtjG4obshvaHAIcKhxSHHscoxzMHPUdHh1HHXAdmR3DHeweFh5AHmoelB6+HukfEx8+H2kflB+/H+ogFSBBIGwgmCDEIPAhHCFIIXUhoSHOIfsiJyJVIoIiryLdIwojOCNmI5QjwiPwJB8kTSR8JKsk2iUJJTglaCWXJccl9yYnJlcmhya3JugnGCdJJ3onqyfcKA0oPyhxKKIo1CkGKTgpaymdKdAqAio1KmgqmyrPKwIrNitpK50r0SwFLDksbiyiLNctDC1BLXYtqy3hLhYuTC6CLrcu7i8kL1ovkS/HL/4wNTBsMKQw2zESMUoxgjG6MfIyKjJjMpsy1DMNM0YzfzO4M/E0KzRlNJ402DUTNU01hzXCNf02NzZyNq426TckN2A3nDfXOBQ4UDiMOMg5BTlCOX85vDn5OjY6dDqyOu87LTtrO6o76DwnPGU8pDzjPSI9YT2hPeA+ID5gPqA+4D8hP2E/oj/iQCNAZECmQOdBKUFqQaxB7kIwQnJCtUL3QzpDfUPARANER0SKRM5FEkVVRZpF3kYiRmdGq0bwRzVHe0fASAVIS0iRSNdJHUljSalJ8Eo3Sn1KxEsMS1NLmkviTCpMcky6TQJNSk2TTdxOJU5uTrdPAE9JT5NP3VAnUHFQu1EGUVBRm1HmUjFSfFLHUxNTX1OqU/ZUQlSPVNtVKFV1VcJWD1ZcVqlW91dEV5JX4FgvWH1Yy1kaWWlZuFoHWlZaplr1W0VblVvlXDVchlzWXSddeF3JXhpebF69Xw9fYV+zYAVgV2CqYPxhT2GiYfViSWKcYvBjQ2OXY+tkQGSUZOllPWWSZedmPWaSZuhnPWeTZ+loP2iWaOxpQ2maafFqSGqfavdrT2una/9sV2yvbQhtYG25bhJua27Ebx5veG/RcCtwhnDgcTpxlXHwcktypnMBc11zuHQUdHB0zHUodYV14XY+dpt2+HdWd7N4EXhueMx5KnmJeed6RnqlewR7Y3vCfCF8gXzhfUF9oX4BfmJ+wn8jf4R/5YBHgKiBCoFrgc2CMIKSgvSDV4O6hB2EgITjhUeFq4YOhnKG14c7h5+IBIhpiM6JM4mZif6KZIrKizCLlov8jGOMyo0xjZiN/45mjs6PNo+ekAaQbpDWkT+RqJIRknqS45NNk7aUIJSKlPSVX5XJljSWn5cKl3WX4JhMmLiZJJmQmfyaaJrVm0Kbr5wcnImc951kndKeQJ6unx2fi5/6oGmg2KFHobaiJqKWowajdqPmpFakx6U4pammGqaLpv2nbqfgqFKoxKk3qamqHKqPqwKrdavprFys0K1ErbiuLa6hrxavi7AAsHWw6rFgsdayS7LCszizrrQltJy1E7WKtgG2ebbwt2i34LhZuNG5SrnCuju6tbsuu6e8IbybvRW9j74KvoS+/796v/XAcMDswWfB48JfwtvDWMPUxFHEzsVLxcjGRsbDx0HHv8g9yLzJOsm5yjjKt8s2y7bMNcy1zTXNtc42zrbPN8+40DnQutE80b7SP9LB00TTxtRJ1MvVTtXR1lXW2Ndc1+DYZNjo2WzZ8dp22vvbgNwF3IrdEN2W3hzeot8p36/gNuC94UThzOJT4tvjY+Pr5HPk/OWE5g3mlucf56noMui86Ubp0Opb6uXrcOv77IbtEe2c7ijutO9A78zwWPDl8XLx//KM8xnzp/Q09ML1UPXe9m32+/eK+Bn4qPk4+cf6V/rn+3f8B/yY/Sn9uv5L/tz/bf//
     Display0: 1920x1080@60Hz scales:1.000000|1.070000
     Display1: 1920x1080@60Hz scales:1.000000|1.070000
     DisplayCount: 2
     HardwareStretching: both=1 window-only=0 full-screen-only=1 none=0 error=0
     Window Device Pixel Ratios: 1.0714285714285714
     ClearType Parameters: \\.\DISPLAY1 [ Gamma: 1.8 Pixel Structure: RGB ClearType Level: 100 Enhanced Contrast: 50 ] \\.\DISPLAY2 [ Gamma: 1.8 Pixel Structure: RGB ClearType Level: 100 Enhanced Contrast: 50 ]
     WebGPU Default Adapter: [object Object]
     WebGPU Fallback Adapter: [object Object]
     Decision Log
     HW_COMPOSITING: available by defaultblocked by runtime: Acceleration blocked by safe-mode
     D3D11_COMPOSITING: unavailable by default: Hardware compositing is disabled
     DIRECT2D: unavailable by default: Direct2D requires Direct3D 11 compositing
     D3D11_HW_ANGLE: unavailable by default: D3D11 compositing is disableddisabled by env: D3D11 compositing is disabled
     GPU_PROCESS: available by defaultblocked by runtime: Safe-mode is enabled
     WEBRENDER: available by defaultunavailable-in-safe-mode by runtime: Safe-mode is enabled
     WEBRENDER_COMPOSITOR: available by defaultunavailable by runtime: No DirectComposition usage
     WEBRENDER_PARTIAL: available by default
     WEBRENDER_SHADER_CACHE: available by defaultunavailable by runtime: WebRender disabled
     WEBRENDER_OPTIMIZED_SHADERS: available by defaultunavailable by runtime: WebRender disabled
     WEBRENDER_ANGLE: available by defaultunavailable-no-angle by runtime: ANGLE is disabled
     WEBRENDER_DCOMP_PRESENT: available by defaultunavailable by env: Requires GPU processunavailable by runtime: Requires ANGLE
     WEBRENDER_SCISSORED_CACHE_CLEARS: available by default
     WEBGPU: available by defaultblocked by runtime: WebGPU cannot be enabled in release or beta
     WINDOW_OCCLUSION: available by default
     VP8_HW_DECODE: available by default
     VP9_HW_DECODE: available by default
     REUSE_DECODER_DEVICE: available by default
     BACKDROP_FILTER: available by default
     CANVAS_RENDERER_THREAD: available by default
     ACCELERATED_CANVAS2D: disabled by default: Disabled by defaultblocked by env: Disabled by Software WebRender
   Crash Guard Disabled Features
   Workarounds
     Failure Log
     (#0) Error: RenderCompositorSWGL failed mapping default framebuffer, no dt
 Media
     Audio Backend: wasapi
     Max Channels: 2
     Preferred Sample Rate: 44100
     Roundtrip latency (standard deviation): 53.54ms (2.89)
     Output Devices
       Name
       Group
       Vendor
       State
       Preferred
       Format
       Channels
       Rate
       Latency
       BenQ EW2440L (NVIDIA High Definition Audio)
       HDAUDIO\FUNC_01&VEN_10DE&DEV_009F&SUBSYS_1028C974&REV_1001\5&327c1d05&0&0001
       Disabled
       None
       default: F32LE, support: S16LE F32LE
       2
       default: 48000, support: 48000 - 48000
       0 - 0
       Headphones (OpenComm by AfterShokz)
       BTHENUM\{0000110b-0000-1000-8000-00805f9b34fb}_VID&0001000a_PID&ffff\7&12d4d79c&0&2074CF75ABB7_C00000000
       Unplugged
       None
       default: F32LE, support: S16LE F32LE
       2
       default: 44100, support: 44100 - 44100
       0 - 0
       Headset (OpenComm by AfterShokz Hands-Free)
       BTHHFENUM\BthHFPAudio\8&33280891&0&97
       Unplugged
       None
       default: F32LE, support: S16LE F32LE
       1
       default: 8000, support: 8000 - 8000
       0 - 0
       Headphones (Realtek(R) Audio)
       HDAUDIO\FUNC_01&VEN_10EC&DEV_1220&SUBSYS_10280AAC&REV_1001\4&331d8fb5&0&0001
       Enabled
       All
       default: F32LE, support: S16LE F32LE
       2
       default: 44100, support: 44100 - 44100
       133 - 448
       Headphones (2- Sport BH032)
       BTHENUM\{0000110b-0000-1000-8000-00805f9b34fb}_VID&0001000a_PID&ffff\7&12d4d79c&0&1A2F23083625_C00000000
       Unplugged
       None
       default: F32LE, support: S16LE F32LE
       2
       default: 48000, support: 48000 - 48000
       0 - 0
     Input Devices
       Name
       Group
       Vendor
       State
       Preferred
       Format
       Channels
       Rate
       Latency
       Headset (OpenComm by AfterShokz)
       BTHHFENUM\BthHFPAudio\8&33280891&0&97
       Unplugged
       None
       default: F32LE, support: S16LE F32LE
       1
       default: 16000, support: 16000 - 16000
       0 - 0
       Stereo Mix (Realtek(R) Audio)
       HDAUDIO\FUNC_01&VEN_10EC&DEV_1220&SUBSYS_10280AAC&REV_1001\4&331d8fb5&0&0001
       Disabled
       None
       default: F32LE, support: S16LE F32LE
       2
       default: 48000, support: 48000 - 48000
       0 - 0
       Headset (2- Sport BH032)
       BTHHFENUM\BthHFPAudio\8&62b66e3&0&97
       Unplugged
       None
       default: F32LE, support: S16LE F32LE
       1
       default: 16000, support: 16000 - 16000
       0 - 0
       Microphone (HD Pro Webcam C920)
       USB\VID_046D&PID_08E5&MI_02\6&3a1e5d21&0&0002
       Enabled
       All
       default: F32LE, support: S16LE F32LE
       2
       default: 32000, support: 32000 - 32000
       96 - 320
     Media Capabilities
     Enumerate database
 Environment Variables
   MOZ_APP_RESTART: 1
   MOZ_CRASHREPORTER_DATA_DIRECTORY: C:\Users\rus\AppData\Roaming\Thunderbird\Crash Reports
   MOZ_CRASHREPORTER_EVENTS_DIRECTORY: C:\Users\rus\AppData\Roaming\Thunderbird\Profiles\lfwiuj3k.default-release\crashes\events
   MOZ_CRASHREPORTER_PING_DIRECTORY: C:\Users\rus\AppData\Roaming\Thunderbird\Pending Pings
   MOZ_CRASHREPORTER_RESTART_ARG_0: C:\Program Files\Mozilla Thunderbird\thunderbird.exe
   MOZ_CRASHREPORTER_STRINGS_OVERRIDE: C:\Program Files\Mozilla Thunderbird\crashreporter-override.ini
   MOZ_LAUNCHER_PROCESS: 1
 Important Modified Preferences
   browser.search.region: JP
   extensions.lastAppVersion: 115.7.0
   font.name.sans-serif.x-western: Times New Roman
   font.size.variable.x-western: 16
   idle.lastDailyNotification: 1707978902
   media.gmp.storage.version.observed: 1
   media.hardware-video-decoding.failed: true
   places.database.lastMaintenance: 1707767770
   privacy.purge_trackers.date_in_cookie_database: 0
   security.enterprise_roots.enabled: true
   security.sandbox.content.tempDirSuffix: {df95932c-0f56-4a5c-83e8-b2d645050458}
   storage.vacuum.last.content-prefs.sqlite: 1705996709
   storage.vacuum.last.index: 1
   storage.vacuum.last.places.sqlite: 1707767770
   ui.osk.debug.keyboardDisplayReason: IKPOS: Touch screen not found.
 Important Locked Preferences
 fission.autostart.session: true
 Places Database
 Accessibility
   Activated: false
   Prevent Accessibility: 0
   Accessible Handler Used:
   Accessibility Instantiator:
 Library Versions
     Expected minimum version
     Version in use
     NSPR
     4.35
     4.35
     NSS
     3.90.1
     3.90.1
     NSSSMIME
     3.90.1
     3.90.1
     NSSSSL
     3.90.1
     3.90.1
     NSSUTIL
     3.90.1
     3.90.1
 Sandbox
   Content Process Sandbox Level: 0
   Effective Content Process Sandbox Level: 1
   Win32k Lockdown State for Content Process: Win32k Lockdown disabled -- Running in Safe Mode
   GPU Process Sandbox Level: 1
 Startup Cache
   Disk Cache Path: C:\Users\rus\AppData\Local\Thunderbird\Profiles\lfwiuj3k.default-release\startupCache\startupCache.8.little
   Ignore Disk Cache: false
   Found Disk Cache on Init: false
   Wrote to Disk Cache: false
 Internationalization & Localization
     Application Settings
     Requested Locales: ["en-US"]
     Available Locales: ["en-US"]
     App Locales: ["en-US"]
     Regional Preferences: ["en-US"]
     Default Locale: "en-US"
     Operating System
     System Locales: ["en-US","ja-JP"]
     Regional Preferences: ["en-US"]
 Remote Debugging (Chromium Protocol)
   Accepting Connections:
   URL:
 Printing
 Modified print settings
   print_printer: Dell Open Print Driver (PCL XL)
   print.more-settings.open: true
   print.printer_Dell_Open_Print_Driver_(PCL_XL).print_duplex: 1
   print.printer_Dell_Open_Print_Driver_(PCL_XL).print_paper_height: 11.6929133858268
   print.printer_Dell_Open_Print_Driver_(PCL_XL).print_paper_id: 9
   print.printer_Dell_Open_Print_Driver_(PCL_XL).print_paper_size_unit: 0
   print.printer_Dell_Open_Print_Driver_(PCL_XL).print_paper_width: 8.26771653543307
   print.printer_Dell_Open_Print_Driver_(PCL_XL).print_unwriteable_margin_bottom_twips: 360
   print.printer_Dell_Open_Print_Driver_(PCL_XL).print_unwriteable_margin_left_twips: 360
   print.printer_Dell_Open_Print_Driver_(PCL_XL).print_unwriteable_margin_right_twips: 360
   print.printer_Dell_Open_Print_Driver_(PCL_XL).print_unwriteable_margin_top_twips: 360

Asked by rus15 5 days ago

Emails

Recently when I forward or send an email there is a whole page of technical jargon that precedes the message. What and how do I get rid of that?

Asked by Ruth Lewis 1 day ago

Show sender email address in inbox listing to detect forged senders

I'm receiving many phishing emails, but when I browse through the list of emails in my inbox then this isn't obvious. In the "from" column I can only see the (forged) nam… (read more)

I'm receiving many phishing emails, but when I browse through the list of emails in my inbox then this isn't obvious. In the "from" column I can only see the (forged) name of the sender displayed and not the sender's email address.

In the past there used to be an add-on to mitigate this problem, but that add-on doesn't work any more for TB 115.6.0 (64-bit).

The add-on was: "Show Address Only" Latest version 0.2.0 Released Sept. 19, 2019 11.9 KiB Works with Thunderbird 68.0 - 77.0 Current maintainer: R.I.P.

When I try to install it, then I get the message: "This add-on is not compatible with your version of Thunderbird. "

I would like to be able to instantly check the sender email address before opening an email. How can I list sender email address instead of only (a forged) name?

This should be basic functionality of Thunderbird.

Asked by Marty 1 week ago

Last reply by Marty 6 days ago

PDF attachment in NEW e-mail opens in browser instead of document viewer

Using Thunderbird 115.6.0 (64-bit) in Linux Mint MATE 21.3. Settings|General|"Save files to is" not selected ("Always ask me where to save files" is.) "Desktop" is shown… (read more)

Using Thunderbird 115.6.0 (64-bit) in Linux Mint MATE 21.3.

Settings|General|"Save files to is" not selected ("Always ask me where to save files" is.) "Desktop" is shown, greyed out.

Note that Settings|General, for Content Types mentioning PDF, the setting is to use Document Viewer (xreader).

Process:

1) Create new e-mail. 2) Add PDF attachment. 3) Double click on the attachment to view.

It opens in Firefox Web browser, instead of in the system's default Document Viewer.

This also creates an empty <random>.html.part file in the Desktop.

Note that viewing a PDF attachment in an incoming e-mail works fine.

It seems there are two problems: The PDF does not open in the Document Viewer, and an empty file is left behind.

The process used to work quite some time ago (many months, anyway) - not sure when.

Any ideas?

Asked by bob71 2 days ago

No purple bar with Accept button in meeting invitation email

Hi, I recently installed a CalDAV server at my workplace to connect to in the Thunderbird calendar, as we all already use Thunderbird for e-mail. If I create a meetin… (read more)

Hi,

I recently installed a CalDAV server at my workplace to connect to in the Thunderbird calendar, as we all already use Thunderbird for e-mail.

If I create a meeting in the calendar and invite everyone else, they all get an email invite with the name, time & place of meeting etc.. And at the top of the email, just below the title of the email, there is a purple bar with boxes saying "Accept", "Tentative", "Deny" and "More" (or something synonymous, I have it in Swedish).

For one employee that purple bar with the "Accept"-box does not appear, and the only way for him to get the meeting to his calendar is by downloading the "invite.ics" file that is attached and importing it afterwards.

I have added two screenshots showing what I mean. One with the Accept, Deny etc. and the one person's e-mail that doesn't have the boxes.


We have checked his settings without finding anything that seems wrong in first glance. I have checked the caldav user account but the user account has the same settings as the others. Thunderbird is updated to the latest version (115.7.0, same as I use and it works for me).

When he invites people to a meeting they all get the invite correctly, so nothing is wrong when he creates a meeting invitation, only when he recieves an invite.

What could be wrong? Is there a setting he might've activated/deactivated in Thunderbird that we missed when looking or could there be something else we have thought of?

Thanks, Tim

Asked by mulshine 1 day ago