I am no longer getting reminders of all the events I have set up in the calendar events.
Hello, I receive my emails in code form. Example: ( X-ProXaD-SC: state=HAM score= . X-ProXaD-Cause: dmFkZTFqxmBzyeewlHBbAR5Y3zkBvqsIpyIUmID8CUp5ji6Ned4J0QIyp1NhWNgFPjk6P… (read more)
Hello, I receive my emails in code form. Example:
( X-ProXaD-SC: state=HAM score= . X-ProXaD-Cause: dmFkZTFqxmBzyeewlHBbAR5Y3zkBvqsIpyIUmID8CUp5ji6Ned4J0QIyp1NhWNgFPjk6PeS1LX1LjSaxLePB8tMou/tWS3xpoRAcG+DE5w8eP8gB8Y9nzkf2CiLsA5RmfNqWUhoKIw+hHcMsG9HzzVWAawpcjtpYd5iZCmHjVb/zHm670d3HwYr5hUrmZSFZB/B/wmikc6NhIXDK5mPvWl1WUfGFbrGoZpCfPbi37zQ3My4I9hVp9tVm/nTu45omfCK3KFyoajtkmG6r9OZ88BW5bNLtiWKikP6eCOKwJLS6IRKx4xrJez814QIqs9c324ppe4LiaNkqaNYyPITio8d8S5izPbQR0nMZ6K8LbzB5WyL7omNQKoPDGMDsuWvd86N/pGUQJsR6LXqYSEiyY/MppZqK2OdGYegF0BozbwMREbSV6XB/aZipnhoeqsAkd//p6Ifym6YZx0yTxVu56YSYg0NUzed9TZtEDX6mfi7ugo9ksiR08u8h6FJ/FqmAhbh7J+SRUYPAQjhzztlqNm8JulYH8rGUjwkHZ3+O5rVuyCD68MT6J4zeRqdcv8Th5ss/n0HfpC+wau1FzzamHf79Qgwmws0IctgJ9AlvV6b5GOCrbs7Got09aOJw8MNSZRLqOSR8oYvbhHAk+8dBYjox8i6ibpPjGAXythtXPhJk79buAg X-ProXaD-Context: Received: from [IPV6:2a01:e0a:153:6890:8549:21aa:815a:5692] (unknown [IPv6:2a01:e0a:153:6890:8549:21aa:815a:5692]) (Authenticated sender: raphael.barteau@free.fr) by smtp6-g21.free.fr (Postfix) with ESMTPSA id A91D378034D for <ho.ka.hey@free.fr>; Wed, 13 Aug 2025 10:24:24 +0200 (CEST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=free.fr; s=smtp-20201208; t=1755073464; bh=m+iJfftWOI9PpWVt7W6EIRRDYw8TuRpdP7qZidUJtE4=; h=Date:To:From:Subject:From; b=fHBGUl2qpN4m8/fre5zWLfOQ3e2xUGxLYhNvMYdljk6meHFeMTmdOGmcXa67zb62x eFOnFF/XZOsCNodApwagewHzjOxx6w1YcjEdLTSElTO2v968YDDUnrreqBbv19/IPI CeFOI/opazy3yDQ6Xua0DRbDZUBv1A13gD9WTBfOjBMXBqEW0mMNJ5KGggPOKkVW1c 13uM76jcbrjLPWzTbU4CZVbGI4vE0sTe/xAp3W7Wvk5xidwupwo19DLGtHYlu7N+Tb z1IvgvUtahr6EXWqMxHVhYLixBaAUp3qw91t7W5VurVr97iojtumJZYW5VZmbwLXy3 6+xmNfPdSExew== Message-ID: <8fad7a1b-440c-4647-8b96-3adcb26da069@free.fr> Date: Wed, 13 Aug 2025 10:24:26 +0200 MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Content-Language: fr To: Ho-Ka-Hey Raphael <ho.ka.hey@free.fr> From: Ho-Ka-Hey Raphael <raphael.barteau@free.fr> Subject: Test Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit
Je test avec la sécurité abaissée ) The problem is only present in Thunderbird; the emails are clearly readable in my provider's online messaging system. In image 1 you can see that there is no subject or the name of the correspondent and in image 2 the email is unreadable... hundreds of lines of code. Could you help me? Thank you very much.
Since midday on the 10th, one of my 2 email clients shows plain text instead of HTML. My optonline email is the one in question. It no longer shows a sender or subject, a… (read more)
Since midday on the 10th, one of my 2 email clients shows plain text instead of HTML. My optonline email is the one in question. It no longer shows a sender or subject, and the body of the email received is in plain text. I have attached an example. Any help would be greatly appreciated. Thanks. Rick.
I am a long term user of thunderbird and its predecessor but I have just installed version 141.0 on a new Windows 11 computer and cannot get the traditional white previe… (read more)
I am a long term user of thunderbird and its predecessor but I have just installed version 141.0 on a new Windows 11 computer and cannot get the traditional white preview screen. Thanks for the suggestion but F8 does not seem to work on my machine. I still have to click on each email to view the contents
Hi. I ve been trying the hole day to add my IONOS email account "r.uhlhorn@starvan.eu" to my thunderbird. It doesnt work. See pictures attached, thunderbird does not ask… (read more)
Hi. I ve been trying the hole day to add my IONOS email account "r.uhlhorn@starvan.eu" to my thunderbird. It doesnt work. See pictures attached, thunderbird does not ask me for any password, only name and email adress. Then it gets stuck completely. Please help.
Best regards, Ralf
I do not know how to fix this problem. I can't not read my emails. Here is an example. Thank you. Mark Nazar X-RG-Rigid: 684BD7C80C8A9B5 . X-RazorGate-Vade: dmFkZTGiFo… (read more)
I do not know how to fix this problem. I can't not read my emails. Here is an example. Thank you. Mark Nazar X-RG-Rigid: 684BD7C80C8A9B5 . X-RazorGate-Vade: dmFkZTGiFojQMBygaQ6XA+0SbzW5ms0jzpNfPUeCflNXFmk86uNVRc+r55f+Ju+XBpZhRH1cj0VdHl5TSDRoMt7M5bhIIBOEStpx9E/Ql0o6zq7khSH4M1NM7wCEVOthy5qXWnmUgZV3TWWvyRv9DAN8YDvPmgOO3/yLqLdLq614SIYlruswQB+TZ3vY6ijx4k+fxiwpwwQiavcmk7mofN68lNzSAXNI9uzH6uBmB9JohvLLCQJcFyaJ9JtGxu8OvCVtzxehKmFxepPXRfnPRmar4xHXjxCqylGiWEoGVIRhYz3oy8DlmMLBrS7MCCPNal9G/VWLTpcM+dNIBNTitSsRaJpySg0HHkK9R3+p0dARlYId2mDlZu/RSLa9XtIHYyoEI4zg4EgRC/TcFnq+NB3jgGsGHALO1fyfZDmEYLH7a1FpKdki4Lzqb4cVYE0d18gCrU66EvrVB6W8MJBnc4i9jLovKtajxov7AInpKWou2WdNjIFxv0gCuH1f51ldHFs8BRJq2zbA7g0k41XavPnU+FuVcKFta99nX/A4Sq/iDHOtEpwOSuPbYBgKg6iV7FsNwb6kyU8kjlRrhzqnw4DWNQVb/wFRtLz8/TtO5XcPnjLygriVPc9k9jufkddYQ+RAsF+TJHHIxvFiTAbA4ZBTPwo3NMzwDjzFqwaPz9XQcU2p+w X-RazorGate-Vade-Verdict: clean 79 X-RazorGate-Vade-Classification: clean Received: from sonic315-24.consmr.mail.ne1.yahoo.com (66.163.190.150) by cmx-torrgi001.bell.net
id 684BD7C80C8A9B55 for marknazar@sympatico.ca; Mon, 11 Aug 2025 15:56:32 -0400
Hello, I hope this message reaches you. I have a Mac operating on OS 10.15 .7. Ever since I upgraded my Thunderbird to the 141.0 version, two things happen: 1) the fans o… (read more)
Hello, I hope this message reaches you. I have a Mac operating on OS 10.15 .7. Ever since I upgraded my Thunderbird to the 141.0 version, two things happen: 1) the fans of my Mac start ventilating very soon (and the battery starts going down) 2) when I quit Thunderbird , everything goes back to normal , but 10 seconds after, a window opens reporting an unexpected shut down. I usually click OK , but when I click "report" , nothing happens. Thanks for your help J.C.
Running Thunderbird with three accounts on my desktop PC - two 'btinternet.com' accounts and one 'gmail.com' account. Inboxes have no more than 20 emails in them, as I… (read more)
Running Thunderbird with three accounts on my desktop PC - two 'btinternet.com' accounts and one 'gmail.com' account. Inboxes have no more than 20 emails in them, as I delete unwanted ones and transfer others to various sub-folders ( In excess of 40 No.). Today I suddenly found that incoming emails on both bt accounts were not showing the subject or sender and the content is displayed in plain text (txt) format - no problem with the gmail account.
I have compacted and repaired the inbox folders but no difference. If I send a message from either of the bt accounts to the other the problem occurs, but if I send a message from either of the bt accounts to my gmail account, it goes through fine. I can receive bt emails fine on my laptop. I assume this is a thunderbird problem on my PC but not sure where to start - would be really grateful for any guidance.
Hi, Since yesterday, the messages I receive are in code. My provider is Orange (France). Of course, the messages are not coded in my Orange mailbox. The protocol I use is… (read more)
Hi, Since yesterday, the messages I receive are in code. My provider is Orange (France). Of course, the messages are not coded in my Orange mailbox. The protocol I use is pop. It looks like all messages are considered as spam. I switched off Bitdefender without solving the problem. Messages start like shown below. Thank you for your help. Alexis
X-ME-engine: defaul . X-me-spamcause: (17)(0000)dmFkZTG3QdvkEcZ12Q0oMIMxMMwayqDM0xuW6cKSqbMStidLeczaRAD0B/il1RO38qThhaj1oj09GWW/odvQFsckvHDMENaquuselcOUGKwkLi1P1ZbXJ6zOysE6iG86VPGRMFfC4No67lrKiUsBubAJUuT02405XOYH7YLivURg6ZPpIpRfyXETjJ/u1LIWBtEcsE7hxMSUSgc8EzXNMhw0bFSgiIbTEppfH/xE/r/GHiG7/78Me6NwliJfX/dI0Hrpv70tJuNL7hQVBwCwFJn2afaQvByrBB3RLn6C/m9UA3F0ZfRZ6EXCrFiZTekgSfr7nB5ZzwVHm+pKoahsOJfGT+y7C+x3of+mnlAM+2db1TQSrOSEXCUK5pN92WNyqYKYS+Zu5TOie2si/JVBsmsauaJR7hVym+4UxrUpmnAb1kl/nY9XFdqaWEIm+WqC2fELo93f5ZbLmnDUpggo5o5d/s9gv8sSvQ3BpaCdTaj2g+kqiChATL1BQXJthd/+IGt75JVEoAPyDh4xQWRKmocWfu26wwRnIRjsPeSzCZb+HkYc4PFzIWskC2Lc3y1gNeyQPDAEfLmR8OKPSowhKjeYjtbnPY31OZbjc4ucw1fCd/NQ1r/3Mi0srX2wKWy96+eC8ytwHdXyRUX5WJ6oUA4/oyxlYoyvriohHqWa/EGJsm6g7g X-me-spamlevel: not-spam ARC-Seal: i=1; a=rsa-sha256; d=orange.fr; s=t20230301; t=1755055666; cv=none; b=SIW7poJk2p67WB7Dosdr6F4CF7WrFxsnj9qC9Wj0DHbRbpFkFELfo/OnnDxPdtfU2p40uRUWDIrUW9U7zcFjp5PSUIZ11vqwiOx4xKv8ZsHnnoernRfQwe+4EmRyOGVqMCsbidnkCCXFAx/16Bq2sCkE1vuydXFST16+Mc0jSpozq45bEONuuWQdtQeEb61eGuJB2Jh2WyP5VGA37ttFiD0t82IV2TqhiRFHw9WtETOOd/D7AJuK8b9MYsW1d0rNB/tWM4yYPqCm69+u9x7zFtPgz+PTb27zkYzUhrxME10sxR9jZ2J7fWwmMYNFUBoT4fzDSicrJSPYebnt1bvgMg== ARC-Message-Signature: i=1; a=rsa-sha256; d=orange.fr; s=t20230301; t=1755055666; c=relaxed/simple; bh=VUHOmlNHSGVBT7drvrxPDfVQ+J85WRZ97/w1UfZirW0=; h=From:To:Subject; b=PEs9j8q0maE6Le6kDFjNe0mR89ZGh/reWMqoDodcQTqpcbAniGU7/6dO6dRA++8OCF8YXTuK2iImRZq7X2BxRLDs8w1+AfsaUiRNuTXRUxz1VGRgE5LiW1RzLAwx90WYYQM5EQfXDHd+h+iNnNLvHgI4a/A2mxxxn0IOTFJ75Z58BSrs8+zePnlzw4KIypSzgqze5ufMUzdjzJiPJtsPMMlU+VLyBcRhWkU2DFs5pV541KI7UJB1KYgnXuEB3UAPYeb9eFO27ZDPHV3tCJ1F2GZaw2/GicrtTJ3JarpxO03XhLdpLvSRR4ALyqAS3/SUSpu8gUimOzy+OTq/6z85zA== ARC-Authentication-Results: i=1; opmta1mti31aub; spf=pass (opmta1mti31aub: domain of sm.22291268386.f4b2124a039fac0e01-news=toner24.fr@emlgrid.com designates 185.54.187.97 as permited sender) smtp.mailfrom=sm.22291268386.f4b2124a039fac0e01-news=toner24.fr@emlgrid.com;
I am receiving emails with no header and look like this when I open them. Can you please help me. Thanks. Ellen Minto X-SNCR-VADESECURE: CLEA . X-RazorGate-Vade: gggru… (read more)
I am receiving emails with no header and look like this when I open them. Can you please help me. Thanks. Ellen Minto
X-SNCR-VADESECURE: CLEA . X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgeeffedrtdefgddufeeihedvucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuueftkffvkffujffvgffngfevqffonecuuegrihhlohhuthemuceftddunecundfotefknffkpffiucdludejmdenucfjughrpefuhfhrvfffkffojefjtgggsegrtddtrehttdejnecuhfhrohhmpeetnhgurhgvficuhghomhhmrggtkhcuofhinhhishhtrhhivghsuceoihhnfhhosegrfihmihdrnhgvtheqnecuggftrfgrthhtvghrnhepudfggeeftddvgfdugfduveeftefgkeehgeejleeflefhvddtvdeuveefueegteegnecuffhomhgrihhnpehlihhsthdqmhgrnhgrghgvrdgtohhmpdhfohhrfigrrhguqdhtohdqfhhrihgvnhgurdgtohhmnecukfhppedugeekrddutdehrddufedrudejfeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhephhgvlhhopehmrghilhdujeefrdhsvggrhedurdhmtghsvhdrnhgvthdpihhnvghtpedugeekrddutdehrddufedrudejfedpmhgrihhlfhhrohhmpegsohhunhgtvgdqmhgtrdhushefpgduudelkeehtdefudekrdegtdehleehiedvqdehrggsleegtggufeejrgesmhgrihhludejfedrshgvrgehuddrmhgtshhvrdhnvghtpdhrvghvkffrpehmrghilhdujeefrdhsvggrhedurdhmtghsvhdrnhgvthdpshhpfhepphgrshhspdgukhhimhepphgrshhspdgumhgrrhgtpehprghsshdpghgvohfkrfepfgfupdfovfet jfhoshhtpegsthhprhgurhhgihdtudefpdhnsggprhgtphhtthhopedupdhrtghpthhtohepvghllhgvnhdrmhhinhhtohessghtihhnthgvrhhnvghtrdgtohhm X-RazorGate-Vade-Verdict: clean 17 X-RazorGate-Vade-Classification: commercial-misc Received: from mail173.sea51.mcsv.net (148.105.13.173) by btprdrgi013.btinternet.com
id 67F5E8B43936DD6D for ellen.minto@btinternet.com; Tue, 12 Aug 2025 23:23:59 +0100
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fbl.mcsv.net; s=k1; t=1755037438; x=1755123838; bh=Fv80o+gL8P6wOiDeQ74uGa8FewmSCxlqcCvdr+a+H5A=; h=Subject:From:Reply-To:To:Date:Message-ID:X-MC-User:Feedback-ID: List-ID:List-Unsubscribe:List-Unsubscribe-Post:Content-Type: MIME-Version:CC:Date:Subject:From; b=RGk9XKxs6nm/9PArbt8kWfh8WpHsDh1NOMwiG6dAJVpTVVJNUNNsGiiPmynAOVW+I XJ7a0Fnq8l4yyICTNCypk93mLxAzkpacnxNuTOvPAOAycHNnGQWmf9W/Pz0mZP7W0v 6uzzHH0r4ehld9/mykeg/0gT4abttYFu8Bmv65xITUN1bURNxAX1vw4GvQAXw6lIPK X8/yOJNV9EoLIUu0gQacR2y3teYLtMQHb72puW7wlmiU+meh0c1jcWn9NpvS5oOWD/ xmNamdh4COs9fX+BCcZO+mHriIXYWBhbA9t0f3gfBVM5CIgfyH6GjQ/mmClBJWmqkw UblED7kXBflQw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=awmi.net; s=k3; t=1755037438; x=1755307438; i=info@awmi.net; bh=Fv80o+gL8P6wOiDeQ74uGa8FewmSCxlqcCvdr+a+H5A=; h=Subject:From:Reply-To:To:Date:Message-ID:X-MC-User:Feedback-ID: List-ID:List-Unsubscribe:List-Unsubscribe-Post:Content-Type: MIME-Version:CC:Date:Subject:From; b=Yhq93DkRgi+W/au3dGcZ7tOHZM+42D2Jmz/vza64jYtqCLoTYujXBocfFCChrGeYT PBu+yNu3UXWPOmZQhwK3zd//CWUXC6SrPpiJLjr9L+NKKz0WV6r2+MLyodscTpXsrs eaZjcvMfMb+pybJ7NuNJHzzbhmd553UJ1pWTIFF7eMdvpoAoiMT9BHgiqR2IK7VBTN uAQkCoCCJ5oLGFkQ8NgQd8wvKdDcd1mZlv3qiUAyZcaZNZozOotzTVrhb2JEFrNfIk EUspCliAhuFqKuLtajpbmQUNeh/KzQL9FdDxEjY8GGzLSXEBhmkKB00xs5WEhrzHvv /awazjgZUVdkg== Received: from localhost (localhost [127.0.0.1]) by mail173.sea51.mcsv.net (Mailchimp) with ESMTP id 4c1mHy0nqDz705hJR for <ellen.minto@btinternet.com>; Tue, 12 Aug 2025 22:23:58 +0000 (GMT) Subject: =?utf-8?Q?=2C=C2=A0It=E2=80=99s=20Time=20to=20Plan=20Ahead=20=E2=80=94=20Your=20Free=20Will=20is=20Waiting?= From: Andrew Wommack Ministries <info@awmi.net> Reply-To: =?utf-8?Q?Andrew=20Wommack=20Ministries?= <info@awmi.net> To: =?utf-8?Q??= <ellen.minto@btinternet.com> Date: Tue, 12 Aug 2025 22:23:46 +0000 Message-ID: <957dee0f9498dc7317c6ae4b4.5ab94cd37a.20250812222336.82ff84bea5.caee7287@mail173.sea51.mcsv.net> X-Mailer: Mailchimp Mailer - **CID82ff84bea55ab94cd37a** X-Campaign: mailchimp957dee0f9498dc7317c6ae4b4.82ff84bea5 X-campaignid: mailchimp957dee0f9498dc7317c6ae4b4.82ff84bea5 X-Report-Abuse: Please report abuse for this campaign here: https://mailchimp.com/contact/abuse/?u=957dee0f9498dc7317c6ae4b4&id=82ff84bea5&e=5ab94cd37a X-MC-User: 957dee0f9498dc7317c6ae4b4 Feedback-ID: 119850318:119850318.4059562:us3:mc List-ID: 957dee0f9498dc7317c6ae4b4mc list <957dee0f9498dc7317c6ae4b4.625017.list-id.mcsv.net> X-Accounttype: pr List-Unsubscribe: <https://gtntv.us3.list-manage.com/unsubscribe?u=957dee0f9498dc7317c6ae4b4&id=3bf9981e3e&t=h&e=5ab94cd37a&c=82ff84bea5>, <mailto:unsubscribe-mc.us3_957dee0f9498dc7317c6ae4b4.82ff84bea5-5ab94cd37a@unsubscribe.mailchimpapp.net?subject=unsubscribe> List-Unsubscribe-Post: List-Unsubscribe=One-Click Content-Type: multipart/alternative; boundary="_----------=_MCPart_1038815606" MIME-Version: 1.0
Hello, I'm using the most recent version of Thunderbird on a desktop using Windows 11. Just this morning (Aug 11), all incoming email to all my four accounts are coming i… (read more)
Hello, I'm using the most recent version of Thunderbird on a desktop using Windows 11. Just this morning (Aug 11), all incoming email to all my four accounts are coming in with no subject or correspondents showing and when opened the email is not formatted in HTML, just plain text and lots of code. I have tried several fixes with no success: repair folders, turn off all add-ons and anti-virus protection, uninstalled and reinstalled software. Can you help, please? Thanks!
Hello there, just started the other day receiving all messages like the following: ...>>> X-RG-Rigid: 688CF4A102060D1 . X-RazorGate-Vade: dmFkZTESH4K2t7Qy069H7o7… (read more)
Hello there, just started the other day receiving all messages like the following: ...>>> X-RG-Rigid: 688CF4A102060D1 . X-RazorGate-Vade: dmFkZTESH4K2t7Qy069H7o7ARq7+UEcTP/p+mewOdcrpAkDwcEMCY8KjZ+huT7sHpUyYo0GMKP5rLavoId/ Kzn7BrA2uYiWtM3duXDkn2pV4Z8... ... ..>>>
They're all valid, except cannot be read anymore. What's wrong please? Thank you so much
Vlad
Hello Everybody . I have used Thunderbird for a number of years and I like it and have supported it from time to time with donations . I am a person with dyslexia and the… (read more)
Hello Everybody . I have used Thunderbird for a number of years and I like it and have supported it from time to time with donations . I am a person with dyslexia and their a lot of people with this problem . more than you would think . The one thing that I think would be nice is to have a speech to text as part of Thunderbird . It would be a big help to us with dyslexia . Thank you for letting me bend your ear .
Robert
Greetings!! I started getting the most bizarre problem over the last couple of days from Thunderbird. Suddenly, for certain emails (not all of them), Thunderbird will s… (read more)
Greetings!!
I started getting the most bizarre problem over the last couple of days from Thunderbird. Suddenly, for certain emails (not all of them), Thunderbird will start truncating the email. The email just stops loading partway through, and the email is not marked as read as it usually is. There is no progress bar at the bottom to indicate that the email is still loading. But, if I view the message source (via the View menu), the whole email is there. It typically happens with emails with either images or ones that fetch some sort of dynamic content.
I've repaired folders, rebuilt summary files, removed parent.lock, restored a backup of both program and message files from two days prior to the problem starting, reinstalled my current version of Thunderbird, rebooted the computer by holding the power button down for a minute, tried Thunderbird Troubleshoot mode, tried Windows 10 Safe Mode, disabled all add-ons, cleared my cache (under disk space), cleared my startup cache, created a new profile, compacted folders, and (temporarily) gave it a free pass through my Firewall. Nothing had any effect.
The Thunderbird Error console doesn't show anything in particular different between emails that load fully and those that do not.
To say I am at my wit's end is an understatement. Is there some sort of simple solution I am totally missing, by any chance? Thank you for any assistance!!!
Are you aware of the problem? Have you installed any Vade cloud software?
Hellow. A year ago ore so, I lost my "Address Book". And this happened when I reinstalled Thunderbird, but used the same profile from the first install. The "Address Book… (read more)
Hellow. A year ago ore so, I lost my "Address Book". And this happened when I reinstalled Thunderbird, but used the same profile from the first install. The "Address Book" was gone...... I am now running 128.13.0esr (64-bit) on Ubuntu 24.04.2 Now I have gathered up "profiles" that I have used over the years and are trying to import them into to days version. But I can't seem to find the AddressBook's file. So can someone please tell me the name of this file and wear it's hidden ?
Hello, Somehow, INBOX is not appearing 3rd AFTER two DRAFTS folders in my email account. I don't know how I managed to change the order, and I cannot change it back. A… (read more)
Hello, Somehow, INBOX is not appearing 3rd AFTER two DRAFTS folders in my email account. I don't know how I managed to change the order, and I cannot change it back.
Any assistance will be appreciated. I'm running Thunderbird 140.1.1esr (64-bit) on a Windows 11 PC. Thanks.
Barb
Is there a way to turn on focused inbox, in Thunderbird, for multiple email accounts?
Bonjour, Depuis l'installation de la version 140.1.1esr de Thunderbird, mes messages arrivent sans objet certain en SPAM .... et commencent tous par X-ME X-ME-engine: de… (read more)
Bonjour, Depuis l'installation de la version 140.1.1esr de Thunderbird, mes messages arrivent sans objet certain en SPAM .... et commencent tous par X-ME X-ME-engine: defaul X-ME-messagetype: clea X-me-spamcause: ......
Dans la bibliothèque il est mentionné "OTR : Échec du chargement. Le chiffrement des discussions OTR ne fonctionnera pas"
Que faire ? Merci de mettre une nouvelle version à disposition pour correction
Starting last night (11/8/25) all my incoming emails (when sent from the UK) are mixed up with tech text from Vade Secure cloud security system. However, 1 message sent f… (read more)
Starting last night (11/8/25) all my incoming emails (when sent from the UK) are mixed up with tech text from Vade Secure cloud security system. However, 1 message sent for France has not been corrupted. Have you implemeted something in the POP servers or otherwise to cause this, please? An extract from in incoming email is below
X-VadeSecure-Status: clea . X-VadeSecure-Cause: gggruggvucftvghtrhhoucdtuddrgeeffedrtdefgddufeehvdejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuqfgiuffgfgdpggftfghnshhusghstghrihgsvgdpgffpggdqvfetnffmvfetnffmnecuuegrihhlohhuthemuceftddunecunecujfgurhepfffhvffkufggtgfjsegrtdersgdttdejnecuhfhrohhmpefvrghlkhfvrghlkhcujfgvlhhpucdjucfuuhhpphhorhhtucevohhmmhhunhhithihuceonhhoqdhrvghplhihsegtohhmmhhunhhithihqdhnohhtihhfihgtrghtihhonhhsrdhtrghlkhhtrghlkhdrtghordhukheqnecuggftrfgrthhtvghrnhepieetueekhefgvdffhfetffehteetuefhfeehueduueeglefgtdekhfeffeduieefnecuffhomhgrihhnpehtrghlkhhtrghlkhdrtghordhukhenucfkphepfeegrddvgeeirdefvddrudehgeenucevlhhushhtvghrufhiiigvpedunecurfgrrhgrmhepihhnvghtpeefgedrvdegiedrfedvrdduheegpdhhvghlohepohhuthgsohhunhguqdgukhhimhdrvghurdhkhhhorhhoshdqmhgrihhlrdgtohhmpdhmrghilhhfrhhomhepnhhoqdhrvghplhihsegtohhmmhhunhhithihqdhnohhtihhfihgtrghtihhonhhsrdhtrghlkhhtrghlkhdrtghordhukhdpnhgspghrtghpthhtohepuddpmhhouggvpehsmhhtphdpghgvthdqufgrfhgvfghnshhusghstghrihgsvgdpghgvohfkrfepihgvpdhsphhfpehprghssh
dpughkihhmpehprghsshdpughmrghrtgepphgrshhspdhrvghvkffrpehouhhtsghouhhnugdqughkihhmrdgvuhdrkhhhohhrohhsqdhmrghilhdrtghomhdrpdhlvggrrhhnihhnghepthhruhgv
X-VadeSecure-Score: 0 X-VadeSecure-SID: 0755e6b1-185b03068736dc37 X-VadeSecure-Dom: oxcloud-pro-eu-1 Authentication-Results: oxseu-vadesecure.net;
iprev=pass policy.iprev=34.246.32.154; spf=pass (sender IP is 34.246.32.154) smtp.mailfrom=no-reply@community-notifications.talktalk.co.uk; dkim=none (message not signed); dmarc=pass action=reject header.from=community-notifications.talktalk.co.uk; arc=none;
X-OX-DMARC: pass (policy=reject) Received-DKIM: Success Received-SPF: Pass Received: from outbound-dkim.eu.khoros-mail.com ([34.246.32.154])
by oxseu3nmtai03p.internal.vadesecure.com with ngmta id 0755e6b1-185b03068e7f6ea6; Tue, 12 Aug 2025 11:56:46 +0000
Received: from community.talktalk.co.uk (unknown [10.250.62.43]) by outbound-dkim.eu.khoros-mail.com (Postfix) with ESMTP id 3BE062802E8 for <jamountford@tiscali.co.uk>; Tue, 12 Aug 2025 11:56:46 +0000 (GMT) DKIM-Filter: OpenDKIM Filter v2.11.0 outbound-dkim.eu.khoros-mail.com 3BE062802E8 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=community-notifications.talktalk.co.uk; s=Lithium1701; t=1754999806; bh=WzRPXv69XTuYEGEzOIqU8E4/hxaqK7jmvtrLZi0nPwk=; h=Date:From:To:Subject:List-Unsubscribe:From:To:Cc: List-Unsubscribe; b=jSHk4T8tcfID7GkSErTCcWk+NuQ9LN384WPLyGwYJH9eKtkbapSm5V8IgZUr0/zpa CPvslCE5of0UbKn7g4WSRG/gFw7cQM1w4aYJLiPvh3msBdSu8nxgoGsLWKGZ4GxoHQ Pwp37kHa1lWc6yKn9ICt7hMHFfAFyisaP2BHe/mE= Date: Tue, 12 Aug 2025 13:56:45 +0200 (CEST) From: TalkTalk Help & Support Community <no-reply@community-notifications.talktalk.co.uk> To: jamountford@tiscali.co.uk Message-ID: <937eec64-b324-4616-8a22-1d4283a8a4dc.1754999806246@community.talktalk.co.uk> Subject: Mandisa-TT mentioned you in TalkTalk Help & Support MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_18113_418549683.1754999806243" List-Unsubscribe-Post: List-Unsubscribe=One-Click List-Unsubscribe: <https://community.talktalk.co.uk/t5/user/removeuseremailpage/user-id/35779/mail-message-tracking/ME8HKK9RSL2X51>
Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: 7bit
