Thunderbird Support Forum

I'm a new Thunderbird user with v115.7.0 on Windows 11, using a mailbox.org account.

Under Account Settings/Copies and Folders/Message Archives/Keep message archives in: I am using the Other setting to point to Local Folders/mailbox.org Archive. Under Archive Options I am using Single Folder and "Keep existing folder structure of archived messages". The example in the options window shows an Archives folder with an Inbox subfolder. However, this doesn't happen.

Messages archived from my Inbox go to Local Folders/mailbox.org Archive/ Messages archived from Inbox/Subfolder go to Local Folders/mailbox.org Archive/Subfolder Messages archived from my Sent items go to Local Folders/mailbox.org Archive/Sent

So of the above, only Sent items go to the correct folder. For anything from the Inbox, the Inbox folder itself is not replicated as per the example on the options page. Can this be corrected?

The inbox listings move once an email is selected. This began upon an upgrade to Debian 11 which included an upgrade to Thunderbird. I had the same issue with an upgrade to Antix 21 recently. That issue was resolved with another upgrade to Thunderbird about a week later.

Several emails in my Earthlink Webmail inbox online received between 6:03 am and 9:21 am PST 2/21/2022 did not download to Thunderbird when I clicked on "Get Messages." They came from 2 different sources from which I have received and downloaded email many times before with no difficulty. Since then I have received and downloaded emails from these same sources, so there appears to be no ongoing problem. Earthlink tech support said there was nothing wrong on their end and my version of Thunderbird is current. This has never happened before in many years of both Earthlink service and using Thunderbird. ??? (No jargon, please, as my tech knowledge is seat of my pants.)

Hi, I would like to eliminate table borders when I reply to a message, or when I forward it. I have tried putting some css code in UserContent.css. For example for "blockquote[type="cite"] table" I use !important. But the borders always remain. Which tag can I use to get border: none ?

1.Running Thunderbird 115.6.0 64 bit on Windows 10. 2.Using Microsoft Defender as AntiVirus and I set Thunderbird profile folder to be excluded from AV. 3.Getting emails from a single Earthlink pop server account. Problem: When clicking Get Messages it works great except yesterday there was one single email on the pop server that would not download properly. It prevented all subsequent messages from downloading. It is a valid email and is not spam. When I searched for the message, it showed multiple times (about 50) in the Thunderbird Inbox. When I deleted the email from the pop server, everything works again. What is there about this messages that causes it to lockup the get message process? Thanks for your help, John

Here is the problem email header: Authentication-Results:mail142c38.carrierzone.com; spf=pass smtp.mailfrom=bankhometown.com Content-Transfer-Encoding:8bit Content-Type:text/plain; charset=us-ascii Date:16 Feb 2024 23:37:56 -0500 Dmarc-Filter:OpenDMARC Filter v1.4.1 mail142c38.carrierzone.com 41H4bxPb013175 From:PPDONOTREPLY@bankhometown.com Message-ID:<3w65bxfyau-1@ppt-gw2.cocci.com> Mime-Version:1.0 Received:from ext-smtp.cocci.com (mail-ext01.cocci.com [204.60.84.37]) by mail142c38.carrierzone.com (8.14.9/8.13.1) with ESMTP id 41H4bxPb013175 for <lisa@bcscompany.com>; Fri, 16 Feb 2024 23:38:02 -0500 Received-Spf:pass (mail142c38.carrierzone.com: domain of ppdonotreply@bankhometown.com designates 204.60.84.37 as permitted sender) receiver=mail142c38.carrierzone.com; client-ip=204.60.84.37; helo=ext-smtp.cocci.com; envelope-from=ppdonotreply@bankhometown.com; x-software=spfmilter 2.001 http://www.acme.com/software/spfmilter/ with libspf2-1.2.10; Return-Path:<ppdonotreply@bankhometown.com> Subject:Positive Pay System Notifications To:lisa@bcscompany.com X-Cocc-Mailscanner:Not scanned: please contact your Internet E-Mail Service Provider for details X-Cocc-Mailscanner-Information:Please contact the ISP for more information X-Cocc-Msgid:DB8A556B4.A1271 X-Da-Pass:W0T0 X-Envelope-From:ppdonotreply@bankhometown.com X-Mime-Autoconverted:from quoted-printable to 8bit by mail142c38.carrierzone.com id 41H4bxPb013175 X-Origin-Country:US X-Spam-Flag:NO X-Vade-Spamcause:gggruggvucftvghtrhhoucdtuddrgedvledrvdefgdejvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffuvffqrffktedpgffpggdqveefkeenuceurghilhhouhhtmecufedtudenucenucfjughrpegghffvfffutgfgkfesthhqredttddtvdenucfhrhhomheprffrfffqpffqvfftgffrnfgjsegsrghnkhhhohhmvghtohifnhdrtghomhenucggtffrrghtthgvrhhnpeekjeehieetvefftedvheekhedvudetffeufeehveejjeetvdfhteegffevleduudenucfkphepvddtgedriedtrdekgedrfeejnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtgedriedtrdekgedrfeejpdhhvghlohepvgigthdqshhmthhprdgtohgttghirdgtohhmpdhmrghilhhfrhhomhepphhpughonhhothhrvghplhihsegsrghnkhhhohhmvghtohifnhdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehlihhsrgessggtshgtohhmphgrnhihrdgtohhm X-Vade-Spamscore:0 X-Vade-Spamstate:clean X-Whl:LR

Dear Mozilla Team,

using Thunderbird I encountered a new problem regarding my Microsoft live.com account. I've had problems logging in, I'm asked for a new password. I've seen that this here seems to be the problem (and solution): https://support.mozilla.org/en-US/kb/microsoft-oauth-authentication-and-thunderbird-202

I've then tried to follow the directions given in the article. However, I cannot change my outgoing smtp settings to Oauth2 (it only gives the options "password, normal", "password, encrypted", "Kerberos", "NTLM" and "No Authentification").

Now, I am not asked for new login data, but my mails do not appear either. It appears, that there is now no successful connection to the server (it keeps getting stuck contacting the host and sending login data; see image attached - in german).

Is there any fix to this?

Best Niklas

Most of my email message filters do not run automatically but will run correctly manually. I am running Thunderbird 115.8.0 (64-bit) on Windows 10. I have 65 filters defined.

I have tried repairing the folders. I have even deleted the old folders and created a new folder. I deleted and recreated all of the .msf files. I have insured that the filer criteria is defined correctly (i.e. multiple condition are "match any", "contains", etc). These efforts have not corrected the problem.

This problem has been around for quite some time. Is there a plan to correct the problem or provide a newer version of message filters that works correctly.

Below is a copy of one of the Filter Log entries of an automatic filter failure. I have included the log entry of the filer being run manually following the failure entry. I have included a screenshot of the pertinent rule:

[2/22/2024, 2:23:55 PM] Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel

[2/22/2024, 2:23:56 PM] Filter action failed: "Move failed" with error code=0x8055000f while attempting: Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel

[2/22/2024, 2:23:56 PM] Filter action failed: "Failed applying the filter action" with error code=0x8055000f while attempting: Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel

[2/22/2024, 2:23:56 PM] Message from filter "From contains: intel.com": Applying filter actions failed

[2/22/2024, 2:23:56 PM] Filter run failed

Manual filter run log entry:

[2/22/2024, 3:15:31 PM] Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel

Many months ago, I created another context for the file explorer drop down to “Send To” Thunderbird, vs the Windows mail client.

Recently, this function stopped working, meaning TB does not open a new message and of course nothing is “attached”.

I detected the addition to the context drop down and then added it (again).

No luck.

My Thunderbird Version = 115.8.0

When I click on a file and open the File Explorer Send To drop down, Windows “shows Thunderbird in the context (my addition) but as noted I don’t have a new message with the file attached.

Correct I’m not using the Mail Client.

Yes, in APPS, Thunderbird is listed as the email client.

Thoughts?

I have a bunch of content in my Local Folders: Junk mailbox but none of it is showing up in Thunderbird. The Properties for the folder shows "Number of messages: 0", "Size on disk: 3.4 MB". I've tried the "Repair Folder" button but it makes no difference. The folder views as empty in Thunderbird.

Not sure when this started happening because I don't recall having this problem in the past. The folder permissions are the same as all the other mailboxes:

ls -l Junk* -rwx------@ 1 uid staff 3578520 23 Feb 08:51 Junk* -rw-r--r--@ 1 uid staff 3289 24 Feb 12:39 Junk.msf

Suggestions welcome.

My Thunderbird(115.8.0) and Windows 11 just don't get along. My Thunderbird has a Menu button in the top right that's just there for it does nothing when I click or right click so I guess no add-ons, calendar, etc. If I hover over it I see "Display the Thunderbird Menu" and that's it. When I open the program it doesn't go to my inbox, it goes to a page that I have to click on "Read Messages" to get to my inbox and in prior versions and I had Windows 10 this never happened. When I go to buttons on the left and click on "Help" and then "About Thunderbird" to check on updates I always get "Unable to check for updates due to internal error" and oh yeah now in Thunderbird I can't copy and paste, I can highlight but when I right click....nothing.

I've tried uninstalling and reinstalling and even tried removing hidden folders, but as of now nothing has worked. I don't know what to think and I'm truly at a loss and it sure looks like I have to find another email program because right now Thunderbird just ain't working. I've been using this program I believe for over 20 years with really zero problems but my luck has apparently run out. Sorry for the mini series. lol

For more than a month, each day when get my emails from my Comcast account, one or more (usually more) of the messages is dated 1/8/2024 and displays the time 6:58 AM. Today I got 6 more. At first, I just deleted them. Then I saved several in a folder and looked at the sender addresses. There were lots of different addresses but, also, some of the addresses were the source of more than one email. I plan on creating a filter to junk any future ones as they come in. I’m posting this primarily out of curiosity. Does someone have an idea of what’s happening? Of what’s causing this 1/8/2024 happening? Thanks.

How can I synchronize my address book across my devices running Thunderbird? I had an app called ZZAddresses that worked well for 10 years or so, until it quit. Does anybody know what happened to it, or what I can use instead? Is Tbird's promised synchronizer going to be real?

In addition to what's in the Subject field, I can "bring back" the hidden emails sooner by clicking another folder, then click back on the folder whose emails disappear (awaiting thermometer). This happens for more than one e-ddress, and also happens when I have a tab open to a given email and press Del.

This doesn't ALWAYS happen, but enough that it's annoying. Anyone else experience this?

Regards, Dave

I receive gmail using Thunderbird version 115.7.0

When I open an email from another gmail account with image attachment, it only shows the file name. Example 'image.jpg' but not download or open option for the file.

Problem solved when I changed Message Body from 'Original HTML' to 'Plain Text'.

It's this normal? Is it a problem caused by the sender? Or it there a better way I can handle this at my end?

Sometimes I can see folders. Other times I can't. And I can't figure out how to change the view. When I search help I get 1384 hits. Clicking on folders in Thunderbird does nothing.