Thunderbird Support Forum

I have a bunch of content in my Local Folders: Junk mailbox but none of it is showing up in Thunderbird. The Properties for the folder shows "Number of messages: 0", "Size on disk: 3.4 MB". I've tried the "Repair Folder" button but it makes no difference. The folder views as empty in Thunderbird.

Not sure when this started happening because I don't recall having this problem in the past. The folder permissions are the same as all the other mailboxes:

ls -l Junk* -rwx------@ 1 uid staff 3578520 23 Feb 08:51 Junk* -rw-r--r--@ 1 uid staff 3289 24 Feb 12:39 Junk.msf

Suggestions welcome.

Hello I have noticed that global Thunderbird search (Ctlr+K) does not index email subjects. So, if I search for keyword which is present only in email subject and not in email body, then search does not return result. If I'm in correct folder and use quick search (Ctrl+Shift+K) with search by subject enabled then it find this email.

Is there any way to search globally by keywords in subject?

How often does Thunderbird log irc chat? Does it log on an interval or only when the application closes? I ask because I saw that some messages from the sever in response to a /whois didn't get logged.

Most of my emails received in Thunderbird have a large amount of HTML script in the message are box, just under the usual from, to, date, subject, etc. It is very irritating and unnecessary. How can I stop this from happening?

Below is what I could copy from one emai; note that I was unable to copy the labels (Message ID:, etc. ) in the box to the left of this data--

by 2002:a05:6918:be2a:b0:20a:3c69:6a17 with SMTP id jl42csp816107ysb; Mon, 4 Mar 2024 08:12:19 -0800 (PST) AGHT+IF+J/VVi57HSAcL4iWcDJvBA2DhC1XueKBRy+DbUKhAgI/s5NuYOHwlRZtfQgQjZ41zFZvI by 2002:a17:902:9a42:b0:1dc:a60f:4bef with SMTP id x2-20020a1709029a4200b001dca60f4befmr9828571plv.63.1709568739588; Mon, 04 Mar 2024 08:12:19 -0800 (PST) i=1; a=rsa-sha256; t=1709568739; cv=none; d=google.com; s=arc-20160816; b=Q+BdEP4W9a+zWUW9U+1HzijaxW6tmIVuswUsNVjjkcIGmKOMvOqwBOZu0kytHyauPP 3KOYNTSYSsu4dDdUwcQjjIGdz3Y7WZ9QXf/wGw9fSb7oeioTpz0UQWiGktR+vDkc122j 8XmDDpWYPGfaEWJsmRnlGES0mRQyg6kbXfTQxEQoiSt/jdECbxomNRg4Dk0d6rYspvfV QhvcdZDhyhMpicCwzMmdd7Srp0xRpg7+eUKzLB8FwxTcC/FQv35/LcnDazYjRRS09vU7 YX2r2n6rSs7sqsO5CzQdvqTlfGUynYZtBXDluIdjsuJQO3AVwEenOpsIn7rJ5ersduNk pHyQ== i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=feedback-id:mime-version:date:message-id:subject:to:sender:from :content-language:dkim-signature:dkim-signature; bh=wQINiGrCE/uJsXN08RO/hzo7pwLtm5+7GIp+2NOrwIg=; fh=G3SsigrUdvMZkQRDAeO8ONLjv2cwfz3u0tvgoq04dgE=; b=bcX1BsUHujz0b8JW1Aqe+4N97UcWx6bTCBamr5uBbuReo0IaTaV8N4+hYiLGhw6xDZ HoT3ts69tt5eFMDssrtKsBIAFA6x2Cd2m1vd1IpVPDT3G/7mc2bgid8ECt3oogBCuYZ0 LioOxa8e6f1APGtHb0UGNV8YW56VWWP910RY0R8G6w9bNXEeuM91LDq1aPAsk7ifz4+F y07v7vGj2c7X++VCA8IpyYCQsTxKGv8gK6++J4qEYwlRzYQJSwOARKmCL2DPP+YVWn3H WsNZFQIZOZ8X8nTnggSCt0KatIaqCgTIKA8J6nnzCGPQEwkunNxEJc6lP+UG1t5CNuQ8 BHcQ==; dara=google.com i=1; mx.google.com; dkim=pass header.i=@firefox.com header.s=ewhfj4b4gqlc3du3533gea5feuzxb5b5 header.b=Xx4H1aJV; dkim=pass header.i=@amazonses.com header.s=hsbnp7p3ensaochzwyq5wwmceodymuwv header.b=KB9Ztqgv; spf=pass (google.com: domain of 0101018e0a3cc735-408b0605-99dc-4d56-ab25-bd6c9979f24b-000000@mail.firefox.com designates 54.240.59.51 as permitted sender) smtp.mailfrom=0101018e0a3cc735-408b0605-99dc-4d56-ab25-bd6c9979f24b-000000@mail.firefox.com; dmarc=pass (p=REJECT sp=REJECT dis=NONE) header.from=firefox.com <0101018e0a3cc735-408b0605-99dc-4d56-ab25-bd6c9979f24b-000000@mail.firefox.com> from a59-51.smtp-out.us-west-2.amazonses.com (a59-51.smtp-out.us-west-2.amazonses.com. [54.240.59.51]) by mx.google.com with ESMTPS id i21-20020a17090320d500b001dc4a8b7a98si8164743plb.509.2024.03.04.08.12.19 for <jmowens81@gmail.com> (version=TLS1_2 cipher=ECDHE-ECDSA-AES128-GCM-SHA256 bits=128/128); Mon, 04 Mar 2024 08:12:19 -0800 (PST) pass (google.com: domain of 0101018e0a3cc735-408b0605-99dc-4d56-ab25-bd6c9979f24b-000000@mail.firefox.com designates 54.240.59.51 as permitted sender) client-ip=54.240.59.51; mx.google.com; dkim=pass header.i=@firefox.com header.s=ewhfj4b4gqlc3du3533gea5feuzxb5b5 header.b=Xx4H1aJV; dkim=pass header.i=@amazonses.com header.s=hsbnp7p3ensaochzwyq5wwmceodymuwv header.b=KB9Ztqgv; spf=pass (google.com: domain of 0101018e0a3cc735-408b0605-99dc-4d56-ab25-bd6c9979f24b-000000@mail.firefox.com designates 54.240.59.51 as permitted sender) smtp.mailfrom=0101018e0a3cc735-408b0605-99dc-4d56-ab25-bd6c9979f24b-000000@mail.firefox.com; dmarc=pass (p=REJECT sp=REJECT dis=NONE) header.from=firefox.com v=1; a=rsa-sha256; q=dns/txt; c=relaxed/simple; s=ewhfj4b4gqlc3du3533gea5feuzxb5b5; d=firefox.com; t=1709568739; h=Content-Type:From:Sender:To:Subject:Message-ID:Date:MIME-Version; bh=jICt34eCrUEPKNLrD50vjwBFu0ZTYc+m8oxNHfPiIVs=; b=Xx4H1aJVwc91HpOLc1VL0Mflu8L1yKkxJpLznuHqHTwIOzUGq7xdzI6bD+LAjZfA WgQXsDIWZHLpACMm/SV3jcXtJfLWOsAs+mAGzTEJsDIH2q7B2xz6d5/XqpkyRMcijij b9JqgvSiktH+qSEa0F1y8xqMs6sPJAGDVgGmju4A= v=1; a=rsa-sha256; q=dns/txt; c=relaxed/simple; s=hsbnp7p3ensaochzwyq5wwmceodymuwv; d=amazonses.com; t=1709568739; h=Content-Type:From:Sender:To:Subject:Message-ID:Date:MIME-Version:Feedback-ID; bh=jICt34eCrUEPKNLrD50vjwBFu0ZTYc+m8oxNHfPiIVs=; b=KB9ZtqgvCuz7l8zUto7qXieQ5XkEioZmrPy9MEKj/GFBS7PCLtgr0C7qBTklfAam xe9gs7fiTgBMj+mtBN59GRUsbBltqaL/kIeOuhNcFsAcVecgSKerqwaG7nU8SsstbfZ h1xMoR7xLmXnQm3/6niNr9HToF8wbsDn74QpjiDc= multipart/alternative; boundary="--_NmP-5861ba3ddeaa29ef-Part_1" en-US newDeviceLogin 7 https://accounts.firefox.com/settings/change_password?email=jmowens81%40gmail.com&utm_medium=email&utm_campaign=fx-new-device-signin&utm_content=fx-change-password 5d285f8735e04a2ab21df59fb8f64460 caac2311b7222febab950af84df6742f3e7169f62a1f018778872df4de435d9f 1709568727968 30b11ae57025e70b 04fb0abc73694614ad8594cacf9a0148 1.0 1.us-west-2.9obwqSuHxAmNPKpejVDo3cEAmnSHOVLO3+B/64gdyXQ=:AmazonSES 2024.03.04-54.240.59.51

I would like to know if I can set up separate folders with subject headings into which I can move and store emails, so that I can easily access all emails relating to a particular subject by opening the folder relating to that subject.

Inbox messages from the month of February inclusive and back disappeared, but just the ones from the "Local Folders" folder, because I have another account and those are intact?

I have a new (one month old) Lenovo Yoga Book 9i with Win 11 and Thunderbird 115.7.0 (64-bit) installed, using Maildir folders. When opening another tab or window to view another folder (Right click, "Open in New Tab" or "Open in New Window"), the new tab or window opens in the new folder as it should. But so does the original tab/window! Opening further tabs and windows and switching between tabs/ windows and clicking on a new folder in any of the open tabs or windows results in all tabs and windows always being synchronized.  In other words, I cannot view two or more separate e-mail folders. They always all synchronize back to one folder. I can never have two different Thunderbird e-mail folders open at the same time!

Never had an issue like this before on other computers or earlier versions of Win/TB, including the same version of TB set up exactly the same way in Win 10 on another computer. As this is my only Win 11 machine, I cannot test it elsewhere. Has anyone else experienced this? Is it a problem with Win 11? Is there a solution, TB config setting perhaps?

For no particualr reason that I can see, all my email subfolders have disappeared today (15 Feb). they were OK yesterday. Very worrying as the filing systems separates and keeps all things I want to keep. Can you help please ? What have I done and can I restore them somehow ? Adrian Simmerson

Hello. As I explained in another question, I use filtering rules to move the incoming emails to their definitive place in a tree of folders, and I look at them through a set of permanent Saved searches using specific criteria this is very handy.

I created the set of saved searches at once (all in the folder _Vues = Views in French), but they don't all work the same, as visible in the attached image: - all properly turn to bold, like other folders, when having messages in unread state, - but some of them don't turn to blue, while others do, when having new messages, - the real folders don't appear to have any problem, they do turn blue when the new messages are moved to them.

This looks like a little cosmetic problem, but it is very annoying as it forces to look at all the searches instead of only the relevant ones.

All the accounts use the option to share a single input and output box in the Local Folders. There is no structural difference between the saved searches (names etc.).

Some emails meet the criteria so should appear in multiple saved searches. I suspect this is the key of the scenario, where for a given incoming email, only the last saved search found matching it would turn to blue, then the global result would depend on the set of incoming emails...

Understanding this would require to know the exact algorithm used.

Can someone explain what happens ?

Thanks, Best regards.

At the older versions of TB, when use Ctrl+K (search for an email address), at the results I could right click and copy the address in order to use it. Now after updates I can NOT do it anymore. This makes hard to use some complicate addreesses, I have to type it and many times I make mistakes by typing.

For more than a month, each day when get my emails from my Comcast account, one or more (usually more) of the messages is dated 1/8/2024 and displays the time 6:58 AM. Today I got 6 more. At first, I just deleted them. Then I saved several in a folder and looked at the sender addresses. There were lots of different addresses but, also, some of the addresses were the source of more than one email. I plan on creating a filter to junk any future ones as they come in. I’m posting this primarily out of curiosity. Does someone have an idea of what’s happening? Of what’s causing this 1/8/2024 happening? Thanks.

Hi, I would like to eliminate table borders when I reply to a message, or when I forward it. I have tried putting some css code in UserContent.css. For example for "blockquote[type="cite"] table" I use !important. But the borders always remain. Which tag can I use to get border: none ?

In addition to what's in the Subject field, I can "bring back" the hidden emails sooner by clicking another folder, then click back on the folder whose emails disappear (awaiting thermometer). This happens for more than one e-ddress, and also happens when I have a tab open to a given email and press Del.

This doesn't ALWAYS happen, but enough that it's annoying. Anyone else experience this?

Regards, Dave

1.Running Thunderbird 115.6.0 64 bit on Windows 10. 2.Using Microsoft Defender as AntiVirus and I set Thunderbird profile folder to be excluded from AV. 3.Getting emails from a single Earthlink pop server account. Problem: When clicking Get Messages it works great except yesterday there was one single email on the pop server that would not download properly. It prevented all subsequent messages from downloading. It is a valid email and is not spam. When I searched for the message, it showed multiple times (about 50) in the Thunderbird Inbox. When I deleted the email from the pop server, everything works again. What is there about this messages that causes it to lockup the get message process? Thanks for your help, John

Here is the problem email header: Authentication-Results:mail142c38.carrierzone.com; spf=pass smtp.mailfrom=bankhometown.com Content-Transfer-Encoding:8bit Content-Type:text/plain; charset=us-ascii Date:16 Feb 2024 23:37:56 -0500 Dmarc-Filter:OpenDMARC Filter v1.4.1 mail142c38.carrierzone.com 41H4bxPb013175 From:PPDONOTREPLY@bankhometown.com Message-ID:<3w65bxfyau-1@ppt-gw2.cocci.com> Mime-Version:1.0 Received:from ext-smtp.cocci.com (mail-ext01.cocci.com [204.60.84.37]) by mail142c38.carrierzone.com (8.14.9/8.13.1) with ESMTP id 41H4bxPb013175 for <lisa@bcscompany.com>; Fri, 16 Feb 2024 23:38:02 -0500 Received-Spf:pass (mail142c38.carrierzone.com: domain of ppdonotreply@bankhometown.com designates 204.60.84.37 as permitted sender) receiver=mail142c38.carrierzone.com; client-ip=204.60.84.37; helo=ext-smtp.cocci.com; envelope-from=ppdonotreply@bankhometown.com; x-software=spfmilter 2.001 http://www.acme.com/software/spfmilter/ with libspf2-1.2.10; Return-Path:<ppdonotreply@bankhometown.com> Subject:Positive Pay System Notifications To:lisa@bcscompany.com X-Cocc-Mailscanner:Not scanned: please contact your Internet E-Mail Service Provider for details X-Cocc-Mailscanner-Information:Please contact the ISP for more information X-Cocc-Msgid:DB8A556B4.A1271 X-Da-Pass:W0T0 X-Envelope-From:ppdonotreply@bankhometown.com X-Mime-Autoconverted:from quoted-printable to 8bit by mail142c38.carrierzone.com id 41H4bxPb013175 X-Origin-Country:US X-Spam-Flag:NO X-Vade-Spamcause:gggruggvucftvghtrhhoucdtuddrgedvledrvdefgdejvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffuvffqrffktedpgffpggdqveefkeenuceurghilhhouhhtmecufedtudenucenucfjughrpegghffvfffutgfgkfesthhqredttddtvdenucfhrhhomheprffrfffqpffqvfftgffrnfgjsegsrghnkhhhohhmvghtohifnhdrtghomhenucggtffrrghtthgvrhhnpeekjeehieetvefftedvheekhedvudetffeufeehveejjeetvdfhteegffevleduudenucfkphepvddtgedriedtrdekgedrfeejnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtgedriedtrdekgedrfeejpdhhvghlohepvgigthdqshhmthhprdgtohgttghirdgtohhmpdhmrghilhhfrhhomhepphhpughonhhothhrvghplhihsegsrghnkhhhohhmvghtohifnhdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehlihhsrgessggtshgtohhmphgrnhihrdgtohhm X-Vade-Spamscore:0 X-Vade-Spamstate:clean X-Whl:LR

Dear Mozilla Team,

using Thunderbird I encountered a new problem regarding my Microsoft live.com account. I've had problems logging in, I'm asked for a new password. I've seen that this here seems to be the problem (and solution): https://support.mozilla.org/en-US/kb/microsoft-oauth-authentication-and-thunderbird-202

I've then tried to follow the directions given in the article. However, I cannot change my outgoing smtp settings to Oauth2 (it only gives the options "password, normal", "password, encrypted", "Kerberos", "NTLM" and "No Authentification").

Now, I am not asked for new login data, but my mails do not appear either. It appears, that there is now no successful connection to the server (it keeps getting stuck contacting the host and sending login data; see image attached - in german).

Is there any fix to this?

Best Niklas

Most of my email message filters do not run automatically but will run correctly manually. I am running Thunderbird 115.8.0 (64-bit) on Windows 10. I have 65 filters defined.

I have tried repairing the folders. I have even deleted the old folders and created a new folder. I deleted and recreated all of the .msf files. I have insured that the filer criteria is defined correctly (i.e. multiple condition are "match any", "contains", etc). These efforts have not corrected the problem.

This problem has been around for quite some time. Is there a plan to correct the problem or provide a newer version of message filters that works correctly.

Below is a copy of one of the Filter Log entries of an automatic filter failure. I have included the log entry of the filer being run manually following the failure entry. I have included a screenshot of the pertinent rule:

[2/22/2024, 2:23:55 PM] Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel

[2/22/2024, 2:23:56 PM] Filter action failed: "Move failed" with error code=0x8055000f while attempting: Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel

[2/22/2024, 2:23:56 PM] Filter action failed: "Failed applying the filter action" with error code=0x8055000f while attempting: Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel

[2/22/2024, 2:23:56 PM] Message from filter "From contains: intel.com": Applying filter actions failed

[2/22/2024, 2:23:56 PM] Filter run failed

Manual filter run log entry:

[2/22/2024, 3:15:31 PM] Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel