Thunderbird Support Forum

why om last updates all my hotmail accounts keep asking me for passwords ? everytime i need to login... your older version was best then this.. i think you make updates with problems , how can i get the older version only ?

I cannot get K9 to accept that I do not have a password verification for my e mail account.When K9 automatically configures my account IMAP and outgoing server it asks for password which I don't have

When using Thunderbird and completing an email chat, I go back to do regular PC work. Later when needing another email I open Thunberbird and it always opens the last email. I was finished with that. How do I get it to open on the main page, not on the last email. Thanks,

Garry

Hello. I can't send a message, the settings are correct. The hoster checked the data, everything is working for him. For some reason the program refuses to work, what should I do?

Here's the error:

Error sending message. Error sending mail: Outgoing mail server (SMTP) error. The server responded: Cannot connect to SMTP server ip (ip), connect error 10060.

Hello,

Similarly to user that asked https://support.mozilla.org/en-US/questions/1376333, I would like to know if an accepted event can be edited – really edited, not just by converting/duplicating it to a task or another event.

For example, if I added an accepted invite to the wrong calendar and would like to move it to another one of my calendars... This calendar switching feature is part of MacOS Calendar, even if, as in Thunderbird, other properties of an accepted invite are not editable (except for comments).

Since this lack of control over invite edition is mainly what is holding me to adopt Thunderbird, is such a feature likely to be deployed eventually?

Regards,

I'm running latest Thunderbird and Windows 10, both up to date

Email reply is not in the Thunderbird sent folder but it is in the BT mail sent folder

Searching Thunderbird finds the email and viewing as list shows location as Sent Checking on laptop running windows 11 gives same result

Suggestions please

1.Running Thunderbird 115.6.0 64 bit on Windows 10. 2.Using Microsoft Defender as AntiVirus and I set Thunderbird profile folder to be excluded from AV. 3.Getting emails from a single Earthlink pop server account. Problem: When clicking Get Messages it works great except yesterday there was one single email on the pop server that would not download properly. It prevented all subsequent messages from downloading. It is a valid email and is not spam. When I searched for the message, it showed multiple times (about 50) in the Thunderbird Inbox. When I deleted the email from the pop server, everything works again. What is there about this messages that causes it to lockup the get message process? Thanks for your help, John

Here is the problem email header: Authentication-Results:mail142c38.carrierzone.com; spf=pass smtp.mailfrom=bankhometown.com Content-Transfer-Encoding:8bit Content-Type:text/plain; charset=us-ascii Date:16 Feb 2024 23:37:56 -0500 Dmarc-Filter:OpenDMARC Filter v1.4.1 mail142c38.carrierzone.com 41H4bxPb013175 From:PPDONOTREPLY@bankhometown.com Message-ID:<3w65bxfyau-1@ppt-gw2.cocci.com> Mime-Version:1.0 Received:from ext-smtp.cocci.com (mail-ext01.cocci.com [204.60.84.37]) by mail142c38.carrierzone.com (8.14.9/8.13.1) with ESMTP id 41H4bxPb013175 for <lisa@bcscompany.com>; Fri, 16 Feb 2024 23:38:02 -0500 Received-Spf:pass (mail142c38.carrierzone.com: domain of ppdonotreply@bankhometown.com designates 204.60.84.37 as permitted sender) receiver=mail142c38.carrierzone.com; client-ip=204.60.84.37; helo=ext-smtp.cocci.com; envelope-from=ppdonotreply@bankhometown.com; x-software=spfmilter 2.001 http://www.acme.com/software/spfmilter/ with libspf2-1.2.10; Return-Path:<ppdonotreply@bankhometown.com> Subject:Positive Pay System Notifications To:lisa@bcscompany.com X-Cocc-Mailscanner:Not scanned: please contact your Internet E-Mail Service Provider for details X-Cocc-Mailscanner-Information:Please contact the ISP for more information X-Cocc-Msgid:DB8A556B4.A1271 X-Da-Pass:W0T0 X-Envelope-From:ppdonotreply@bankhometown.com X-Mime-Autoconverted:from quoted-printable to 8bit by mail142c38.carrierzone.com id 41H4bxPb013175 X-Origin-Country:US X-Spam-Flag:NO X-Vade-Spamcause:gggruggvucftvghtrhhoucdtuddrgedvledrvdefgdejvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffuvffqrffktedpgffpggdqveefkeenuceurghilhhouhhtmecufedtudenucenucfjughrpegghffvfffutgfgkfesthhqredttddtvdenucfhrhhomheprffrfffqpffqvfftgffrnfgjsegsrghnkhhhohhmvghtohifnhdrtghomhenucggtffrrghtthgvrhhnpeekjeehieetvefftedvheekhedvudetffeufeehveejjeetvdfhteegffevleduudenucfkphepvddtgedriedtrdekgedrfeejnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtgedriedtrdekgedrfeejpdhhvghlohepvgigthdqshhmthhprdgtohgttghirdgtohhmpdhmrghilhhfrhhomhepphhpughonhhothhrvghplhihsegsrghnkhhhohhmvghtohifnhdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehlihhsrgessggtshgtohhmphgrnhihrdgtohhm X-Vade-Spamscore:0 X-Vade-Spamstate:clean X-Whl:LR

When I attempt to retrieve mail (from some accounts) I receive the error message "account being processed, please wait until completion to download the messages" (see att.). Even after a long time (hours) the same happens - so I have to use my phone or IMAPS to get my messages. This happens only since I upgraded to Supernova (currently 115.7.0) and apparently on mail server orange.fr (but not all my mail accounts on orange.fr). I did not change (manually) any setting. Other mail servers (including wanadoo.fr which is an orange.fr mail server) seem to work ok. Thanks for any help & BR Max.

Dear Mozilla Team,

using Thunderbird I encountered a new problem regarding my Microsoft live.com account. I've had problems logging in, I'm asked for a new password. I've seen that this here seems to be the problem (and solution): https://support.mozilla.org/en-US/kb/microsoft-oauth-authentication-and-thunderbird-202

I've then tried to follow the directions given in the article. However, I cannot change my outgoing smtp settings to Oauth2 (it only gives the options "password, normal", "password, encrypted", "Kerberos", "NTLM" and "No Authentification").

Now, I am not asked for new login data, but my mails do not appear either. It appears, that there is now no successful connection to the server (it keeps getting stuck contacting the host and sending login data; see image attached - in german).

Is there any fix to this?

Best Niklas

Hello all,

I haven't opened my email-client Tunderbird since 13.07.2023. I've opened it today and due to automatic downloading with start, it downloaded nearyl 2200 emails.

But they don't appear in my inbox. I can't find them via search. Due to automatical deletion via smtp they're not in my email account anymore.

Can you please help fixing this issue?

BR Thiemo Neumann

I am trying to move back to Thunderbird from Apple Mail. The issue I am having is that Thunderbird is not pulling my sent messages on my Mac or in Linux. When I used Thunderbird in the past this was not an issue. I checked the forum and my iCloud and Fastmail accounts are set up as IMAP. What has me confused is that Thunderbird pulled three messages with very old dates but nothing else.

I receive gmail using Thunderbird version 115.7.0

When I open an email from another gmail account with image attachment, it only shows the file name. Example 'image.jpg' but not download or open option for the file.

Problem solved when I changed Message Body from 'Original HTML' to 'Plain Text'.

It's this normal? Is it a problem caused by the sender? Or it there a better way I can handle this at my end?

After some moment thunderbird cant receive sended emails from server. Its downloading messages and after that, when im trying to open a blank message the new is arriving. I was trying to "repair" folder and also completely reintstall thunderbird - nothing changed. Could someone give an advise how to solve this?