Showing questions tagged: Show all questions

getting messages from pop server

1.Running Thunderbird 115.6.0 64 bit on Windows 10. 2.Using Microsoft Defender as AntiVirus and I set Thunderbird profile folder to be excluded from AV. 3.Getting emails … (read more)

1.Running Thunderbird 115.6.0 64 bit on Windows 10. 2.Using Microsoft Defender as AntiVirus and I set Thunderbird profile folder to be excluded from AV. 3.Getting emails from a single Earthlink pop server account. Problem: When clicking Get Messages it works great except yesterday there was one single email on the pop server that would not download properly. It prevented all subsequent messages from downloading. It is a valid email and is not spam. When I searched for the message, it showed multiple times (about 50) in the Thunderbird Inbox. When I deleted the email from the pop server, everything works again. What is there about this messages that causes it to lockup the get message process? Thanks for your help, John

Here is the problem email header: Authentication-Results:mail142c38.carrierzone.com; spf=pass smtp.mailfrom=bankhometown.com Content-Transfer-Encoding:8bit Content-Type:text/plain; charset=us-ascii Date:16 Feb 2024 23:37:56 -0500 Dmarc-Filter:OpenDMARC Filter v1.4.1 mail142c38.carrierzone.com 41H4bxPb013175 From:PPDONOTREPLY@bankhometown.com Message-ID:<3w65bxfyau-1@ppt-gw2.cocci.com> Mime-Version:1.0 Received:from ext-smtp.cocci.com (mail-ext01.cocci.com [204.60.84.37]) by mail142c38.carrierzone.com (8.14.9/8.13.1) with ESMTP id 41H4bxPb013175 for <lisa@bcscompany.com>; Fri, 16 Feb 2024 23:38:02 -0500 Received-Spf:pass (mail142c38.carrierzone.com: domain of ppdonotreply@bankhometown.com designates 204.60.84.37 as permitted sender) receiver=mail142c38.carrierzone.com; client-ip=204.60.84.37; helo=ext-smtp.cocci.com; envelope-from=ppdonotreply@bankhometown.com; x-software=spfmilter 2.001 http://www.acme.com/software/spfmilter/ with libspf2-1.2.10; Return-Path:<ppdonotreply@bankhometown.com> Subject:Positive Pay System Notifications To:lisa@bcscompany.com X-Cocc-Mailscanner:Not scanned: please contact your Internet E-Mail Service Provider for details X-Cocc-Mailscanner-Information:Please contact the ISP for more information X-Cocc-Msgid:DB8A556B4.A1271 X-Da-Pass:W0T0 X-Envelope-From:ppdonotreply@bankhometown.com X-Mime-Autoconverted:from quoted-printable to 8bit by mail142c38.carrierzone.com id 41H4bxPb013175 X-Origin-Country:US X-Spam-Flag:NO X-Vade-Spamcause:gggruggvucftvghtrhhoucdtuddrgedvledrvdefgdejvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffuvffqrffktedpgffpggdqveefkeenuceurghilhhouhhtmecufedtudenucenucfjughrpegghffvfffutgfgkfesthhqredttddtvdenucfhrhhomheprffrfffqpffqvfftgffrnfgjsegsrghnkhhhohhmvghtohifnhdrtghomhenucggtffrrghtthgvrhhnpeekjeehieetvefftedvheekhedvudetffeufeehveejjeetvdfhteegffevleduudenucfkphepvddtgedriedtrdekgedrfeejnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtgedriedtrdekgedrfeejpdhhvghlohepvgigthdqshhmthhprdgtohgttghirdgtohhmpdhmrghilhhfrhhomhepphhpughonhhothhrvghplhihsegsrghnkhhhohhmvghtohifnhdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehlihhsrgessggtshgtohhmphgrnhihrdgtohhm X-Vade-Spamscore:0 X-Vade-Spamstate:clean X-Whl:LR

Asked by john395 2 months ago

Thunderbird upgrade to 117.7.0 in Debian 11 has caused the inbox entries to jump once selected

The inbox listings move once an email is selected. This began upon an upgrade to Debian 11 which included an upgrade to Thunderbird. I had the same issue with an upgrade … (read more)

The inbox listings move once an email is selected. This began upon an upgrade to Debian 11 which included an upgrade to Thunderbird. I had the same issue with an upgrade to Antix 21 recently. That issue was resolved with another upgrade to Thunderbird about a week later.

Asked by schmitt28 2 months ago

Email message filters do not run automatically but will run correctly manually.

Most of my email message filters do not run automatically but will run correctly manually. I am running Thunderbird 115.8.0 (64-bit) on Windows 10. I have 65 filters defi… (read more)

Most of my email message filters do not run automatically but will run correctly manually. I am running Thunderbird 115.8.0 (64-bit) on Windows 10. I have 65 filters defined.

I have tried repairing the folders. I have even deleted the old folders and created a new folder. I deleted and recreated all of the .msf files. I have insured that the filer criteria is defined correctly (i.e. multiple condition are "match any", "contains", etc). These efforts have not corrected the problem.

This problem has been around for quite some time. Is there a plan to correct the problem or provide a newer version of message filters that works correctly.

Below is a copy of one of the Filter Log entries of an automatic filter failure. I have included the log entry of the filer being run manually following the failure entry. I have included a screenshot of the pertinent rule:


[2/22/2024, 2:23:55 PM] Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel

[2/22/2024, 2:23:56 PM] Filter action failed: "Move failed" with error code=0x8055000f while attempting: Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel

[2/22/2024, 2:23:56 PM] Filter action failed: "Failed applying the filter action" with error code=0x8055000f while attempting: Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel

[2/22/2024, 2:23:56 PM] Message from filter "From contains: intel.com": Applying filter actions failed

[2/22/2024, 2:23:56 PM] Filter run failed


Manual filter run log entry:

[2/22/2024, 3:15:31 PM] Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel

Asked by Phil 2 months ago

Email download problem

Several emails in my Earthlink Webmail inbox online received between 6:03 am and 9:21 am PST 2/21/2022 did not download to Thunderbird when I clicked on "Get Messages." … (read more)

Several emails in my Earthlink Webmail inbox online received between 6:03 am and 9:21 am PST 2/21/2022 did not download to Thunderbird when I clicked on "Get Messages." They came from 2 different sources from which I have received and downloaded email many times before with no difficulty. Since then I have received and downloaded emails from these same sources, so there appears to be no ongoing problem. Earthlink tech support said there was nothing wrong on their end and my version of Thunderbird is current. This has never happened before in many years of both Earthlink service and using Thunderbird. ??? (No jargon, please, as my tech knowledge is seat of my pants.)

Asked by horsedrawn 2 months ago

WIN TO "File Explorer" Send To function, no longer opens a TB new msg and, of course does, not attach tgt file

Many months ago, I created another context for the file explorer drop down to “Send To” Thunderbird, vs the Windows mail client. Recently, this function stopped working,… (read more)

Many months ago, I created another context for the file explorer drop down to “Send To” Thunderbird, vs the Windows mail client.

Recently, this function stopped working, meaning TB does not open a new message and of course nothing is “attached”.

I detected the addition to the context drop down and then added it (again).

No luck.

My Thunderbird Version = 115.8.0

When I click on a file and open the File Explorer Send To drop down, Windows “shows Thunderbird in the context (my addition) but as noted I don’t have a new message with the file attached.

Correct I’m not using the Mail Client.

Yes, in APPS, Thunderbird is listed as the email client.

Thoughts?

Asked by TedT_USA 2 months ago

Junk folder contents not shown (on MacOS Sonoma latest).

I have a bunch of content in my Local Folders: Junk mailbox but none of it is showing up in Thunderbird. The Properties for the folder shows "Number of messages: 0", "Siz… (read more)

I have a bunch of content in my Local Folders: Junk mailbox but none of it is showing up in Thunderbird. The Properties for the folder shows "Number of messages: 0", "Size on disk: 3.4 MB". I've tried the "Repair Folder" button but it makes no difference. The folder views as empty in Thunderbird.

Not sure when this started happening because I don't recall having this problem in the past. The folder permissions are the same as all the other mailboxes:

ls -l Junk* -rwx------@ 1 uid staff 3578520 23 Feb 08:51 Junk* -rw-r--r--@ 1 uid staff 3289 24 Feb 12:39 Junk.msf

Suggestions welcome.

Asked by phbcanada 2 months ago

thunderbird adds files to local folder everytime I open Thunderbird

So I downloaded my Receipts folder from my yahoo mail to a local folder on my desktop. When I start Thunderbird it adds a copy of the folder and several other files every… (read more)

So I downloaded my Receipts folder from my yahoo mail to a local folder on my desktop. When I start Thunderbird it adds a copy of the folder and several other files every time over and over again. I delete them and they just come back. example: Receipt folder Receipt folder copy.sbd Trash Trash.msf Unsent messages Unsent messages.msf Is there any way to prevent this?

Asked by ajpetersen2001 2 months ago

Cannot delete a rss folder

I subscribed to a blog as I usually do in Thunderbird but it ended up as a folder. I've tried to delete it but it doesn't go away. There are no posts in it either and res… (read more)

I subscribed to a blog as I usually do in Thunderbird but it ended up as a folder. I've tried to delete it but it doesn't go away. There are no posts in it either and resubscribing to the blog doesn't work - it just says I'm already subscribed. Any suggestions?

Asked by shugal 2 months ago

Can I combine emails with different subjects?

I have a bunch of separate email threads regarding the same issue, but since different people have gotten involved over time they are sporting different subjects and ther… (read more)

I have a bunch of separate email threads regarding the same issue, but since different people have gotten involved over time they are sporting different subjects and therefore aren't all in the same place. Is a folder the only way to do it? It just seems to me that being able to drag them together as a single Inbox item isn't an unusual thought.

Asked by Art 2 months ago

Thunderbird update

My Thunderbird just did an auto update and now the new update screen does not show Thunderbird at the top of the page or the usual About options or reinstall a previous v… (read more)

My Thunderbird just did an auto update and now the new update screen does not show Thunderbird at the top of the page or the usual About options or reinstall a previous version. I lost all of my important folders and my 3 email accounts with their folders. What happened? And, how do I get them back. I cannot even tell what version of this Thunderbird I have now !!!!! The image below is what my new Thunderbird page looks like. :(

Asked by Alex 2 months ago

Exchange Contacts missing addresses and phone numbers in Thunderbird

Hello :) I am using Thunderbird on Fedora 39. I am also using the OWL add-on which I guess is on a trial for the next 30 days. Anyway; my one and only email accoun… (read more)

Hello :) I am using Thunderbird on Fedora 39. I am also using the OWL add-on which I guess is on a trial for the next 30 days.

Anyway; my one and only email account is hosted Exchange (office365) through Rackspace. When I set up Thunderbird to use my email, everything seems to work and work flawlessly with the exception of Contacts.

All of my contacts are listed, but they are all mostly missing their phone numbers and addresses. I have not LOST any data to my knowledge (My mobile devices and three other computers running either Windows 11 or macOS Sonoma still show all of the missing information). My concern is that if this info is missing and I go to put in a new address or phone number in Thunderbird, that I might mistakenly delete information when updating a record when it goes to sync.

Anyone know what is going on?

Asked by J_DVX 2 months ago

emails not downloading and delayed downloading - should I reinstall

I have been using Thunderbird for more than 15 years, and now everything has gone haywire I have 4 email accounts, of which the primary two are set up as pop accounts. … (read more)

I have been using Thunderbird for more than 15 years, and now everything has gone haywire I have 4 email accounts, of which the primary two are set up as pop accounts. Yahoo is one of the two pop accounts. However, starting Sunday, the yahoo emails would not download, but the other account would. I tried all sorts of things, and now I am having trouble with the other account's emails to download, and when they do, it takes 10 minutes or so for them to download. I am extremely frustrated. Will a reinstall help? Larry

Asked by lh12 2 months ago

email sub-folders disappeared

For no particualr reason that I can see, all my email subfolders have disappeared today (15 Feb). they were OK yesterday. Very worrying as the filing systems separates … (read more)

For no particualr reason that I can see, all my email subfolders have disappeared today (15 Feb). they were OK yesterday. Very worrying as the filing systems separates and keeps all things I want to keep. Can you help please ? What have I done and can I restore them somehow ? Adrian Simmerson

Asked by af7 2 months ago

Why did all of my inbox messages disappear?

Suddenly all of the hundreds of messages in my inbox have disappeared. Even newer messages appear briefly and then disappear. They are not in my Trash file or archived. T… (read more)

Suddenly all of the hundreds of messages in my inbox have disappeared. Even newer messages appear briefly and then disappear. They are not in my Trash file or archived. They are just gone. This is a disaster, as several of the messages were needing to be responded to.


 Application Basics
   Name: Thunderbird
   Version: 115.7.0
   Build ID: 20240119095007
   Distribution ID:
   Update Channel: release
   User Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:115.0) Gecko/20100101 Thunderbird/115.7.0
   OS: Windows_NT 10.0 22621
   OS Theme:
   Launcher Process: Enabled
   Multiprocess Windows: 0/0
   Fission Windows: 0/0
             Enabled by default
   Remote Processes: 0
   Enterprise Policies: Inactive
   Google Location Service Key: Missing
   Google Safebrowsing Key: Missing
   Mozilla Location Service Key: Missing
   Safe Mode: true
   Memory Size (RAM): 15.7 GB
   Disk Space Available: 297 GB
 Mail and News Accounts
   account1:
     INCOMING: account1, , (imap) mail.rlhowser.com:993, SSL, passwordCleartext
     OUTGOING: , mail.rlhowser.com:465, SSL, passwordCleartext, true
   account2:
     INCOMING: account2, , (none) Local Folders, 0, passwordCleartext
   account4:
     INCOMING: account4, , (pop3) pop.asahi-net.or.jp:995, SSL, passwordCleartext
     OUTGOING: , mail.asahi-net.or.jp:465, SSL, passwordCleartext, true
 Libraries
     Library
     Status
     Expected minimum version
     Version in use
     Path
     RNP (OpenPGP)
 Calendar Settings
   Home
     Name
     Value
     Name:
     Type: storage
     Disabled: true
     Username:
     URI:
     Refresh Interval:
     Read-only:
     Suppress Alarms:
     Cache Enabled:
     iMIP Identity: id1
     iMIP Disabled:
     iMIP Account:
     Organizer Id:
     Force Email Scheduling:
     Popup Alarms Supported:
     Alarms on Invitation Supported:
     Max Alarms Per Event:
     Attachment Supported:
     Max Categories:
     Privacy State Supported:
     Priority Supported: true
     Event Supported:
     Task Supported:
     Local Time Supported:
     UTC/GMT Supported:
     Auto-Scheduling Supported:
 Crash Reports for the Last 3 Days
 Remote Processes
   Type: Count
 Add-ons
     Name
     Type
     Version
     Enabled
     ID
       Amazon.com
       extension
       1.1
       true
       amazondotcom@search.mozilla.org
       Bing
       extension
       1.0
       true
       bing@search.mozilla.org
       DuckDuckGo
       extension
       1.0
       true
       ddg@search.mozilla.org
       Google
       extension
       1.0
       true
       google@search.mozilla.org
       Wikipedia (en)
       extension
       1.0
       true
       wikipedia@search.mozilla.org
 Security Software
   Type: Name
     Antivirus: AVG Antivirus
     Antispyware:
     Firewall: Windows Firewall
 Graphics
     Features
     Compositing: WebRender (Software)
     Asynchronous Pan/Zoom: wheel input enabled; scrollbar drag enabled; keyboard enabled; autoscroll enabled; smooth pinch-zoom enabled
     WebGL 1 Driver WSI Info: -
     WebGL 1 Driver Renderer: WebGL is currently disabled.
     WebGL 1 Driver Version: -
     WebGL 1 Driver Extensions: -
     WebGL 1 Extensions: -
     WebGL 2 Driver WSI Info: -
     WebGL 2 Driver Renderer: WebGL is currently disabled.
     WebGL 2 Driver Version: -
     WebGL 2 Driver Extensions: -
     WebGL 2 Extensions: -
     Target Frame Rate: 59
     DirectWrite: true (10.0.22621.3085)
     GPU #1
     Active: Yes
     Description: NVIDIA GeForce RTX 3060
     Vendor ID: 0x10de
     Device ID: 0x2504
     Driver Version: 31.0.15.4633
     Driver Date: 12-6-2023
     Drivers: C:\WINDOWS\System32\DriverStore\FileRepository\nvddi.inf_amd64_eeb78e7fd073f332\nvldumdx.dll,C:\WINDOWS\System32\DriverStore\FileRepository\nvddi.inf_amd64_eeb78e7fd073f332\nvldumdx.dll,C:\WINDOWS\System32\DriverStore\FileRepository\nvddi.inf_amd64_eeb78e7fd073f332\nvldumdx.dll,C:\WINDOWS\System32\DriverStore\FileRepository\nvddi.inf_amd64_eeb78e7fd073f332\nvldumdx.dll C:\WINDOWS\System32\DriverStore\FileRepository\nvddi.inf_amd64_eeb78e7fd073f332\nvldumd.dll,C:\WINDOWS\System32\DriverStore\FileRepository\nvddi.inf_amd64_eeb78e7fd073f332\nvldumd.dll,C:\WINDOWS\System32\DriverStore\FileRepository\nvddi.inf_amd64_eeb78e7fd073f332\nvldumd.dll,C:\WINDOWS\System32\DriverStore\FileRepository\nvddi.inf_amd64_eeb78e7fd073f332\nvldumd.dll
     Subsys ID: 00000000
     RAM: 12288
     GPU #2
     Active: No
     RAM: 0
     Diagnostics
     AzureCanvasBackend: skia
     AzureContentBackend: skia
     AzureFallbackCanvasBackend: skia
     CMSOutputProfile: AAAMSExpbm8CEAAAbW50clJHQiBYWVogB84AAgAJAAYAMQAAYWNzcE1TRlQAAAAASUVDIHNSR0IAAAAAAAAAAAAAAAAAAPbWAAEAAAAA0y1IUCAgAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAARY3BydAAAAVAAAAAzZGVzYwAAAYQAAABsd3RwdAAAAfAAAAAUYmtwdAAAAgQAAAAUclhZWgAAAhgAAAAUZ1hZWgAAAiwAAAAUYlhZWgAAAkAAAAAUZG1uZAAAAlQAAABwZG1kZAAAAsQAAACIdnVlZAAAA0wAAACGdmlldwAAA9QAAAAkbHVtaQAAA/gAAAAUbWVhcwAABAwAAAAkdGVjaAAABDAAAAAMclRSQwAABDwAAAgMZ1RSQwAABDwAAAgMYlRSQwAABDwAAAgMdGV4dAAAAABDb3B5cmlnaHQgKGMpIDE5OTggSGV3bGV0dC1QYWNrYXJkIENvbXBhbnkAAGRlc2MAAAAAAAAAEnNSR0IgSUVDNjE5NjYtMi4xAAAAAAAAAAAAAAASc1JHQiBJRUM2MTk2Ni0yLjEAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAFhZWiAAAAAAAADzUQABAAAAARbMWFlaIAAAAAAAAAAAAAAAAAAAAABYWVogAAAAAAAAb6IAADj1AAADkFhZWiAAAAAAAABimQAAt4UAABjaWFlaIAAAAAAAACSgAAAPhAAAts9kZXNjAAAAAAAAABZJRUMgaHR0cDovL3d3dy5pZWMuY2gAAAAAAAAAAAAAABZJRUMgaHR0cDovL3d3dy5pZWMuY2gAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAZGVzYwAAAAAAAAAuSUVDIDYxOTY2LTIuMSBEZWZhdWx0IFJHQiBjb2xvdXIgc3BhY2UgLSBzUkdCAAAAAAAAAAAAAAAuSUVDIDYxOTY2LTIuMSBEZWZhdWx0IFJHQiBjb2xvdXIgc3BhY2UgLSBzUkdCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGRlc2MAAAAAAAAALFJlZmVyZW5jZSBWaWV3aW5nIENvbmRpdGlvbiBpbiBJRUM2MTk2Ni0yLjEAAAAAAAAAAAAAACxSZWZlcmVuY2UgVmlld2luZyBDb25kaXRpb24gaW4gSUVDNjE5NjYtMi4xAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAB2aWV3AAAAAAATpP4AFF8uABDPFAAD7cwABBMLAANcngAAAAFYWVogAAAAAABMCVYAUAAAAFcf521lYXMAAAAAAAAAAQAAAAAAAAAAAAAAAAAAAAAAAAKPAAAAAnNpZyAAAAAAQ1JUIGN1cnYAAAAAAAAEAAAAAAUACgAPABQAGQAeACMAKAAtADIANwA7AEAARQBKAE8AVABZAF4AYwBoAG0AcgB3AHwAgQCGAIsAkACVAJoAnwCkAKkArgCyALcAvADBAMYAywDQANUA2wDgAOUA6wDwAPYA+wEBAQcBDQETARkBHwElASsBMgE4AT4BRQFMAVIBWQFgAWcBbgF1AXwBgwGLAZIBmgGhAakBsQG5AcEByQHRAdkB4QHpAfIB+gIDAgwCFAIdAiYCLwI4AkECSwJUAl0CZwJxAnoChAKOApgCogKsArYCwQLLAtUC4ALrAvUDAAMLAxYDIQMtAzgDQwNPA1oDZgNyA34DigOWA6IDrgO6A8cD0wPgA+wD+QQGBBMEIAQtBDsESARVBGMEcQR+BIwEmgSoBLYExATTBOEE8AT+BQ0FHAUrBToFSQVYBWcFdwWGBZYFpgW1BcUF1QXlBfYGBgYWBicGNwZIBlkGagZ7BowGnQavBsAG0QbjBvUHBwcZBysHPQdPB2EHdAeGB5kHrAe/B9IH5Qf4CAsIHwgyCEYIWghuCIIIlgiqCL4I0gjnCPsJEAklCToJTwlkCXkJjwmkCboJzwnlCfsKEQonCj0KVApqCoEKmAquCsUK3ArzCwsLIgs5C1ELaQuAC5gLsAvIC+EL+QwSDCoMQwxcDHUMjgynDMAM2QzzDQ0NJg1ADVoNdA2ODakNww3eDfgOEw4uDkkOZA5/DpsOtg7SDu4PCQ8lD0EPXg96D5YPsw/PD+wQCRAmEEMQYRB+EJsQuRDXEPURExExEU8RbRGMEaoRyRHoEgcSJhJFEmQShBKjEsMS4xMDEyMTQxNjE4MTpBPFE+UUBhQnFEkUahSLFK0UzhTwFRIVNBVWFXgVmxW9FeAWAxYmFkkWbBaPFrIW1hb6Fx0XQRdlF4kXrhfSF/cYGxhAGGUYihivGNUY+hkgGUUZaxmRGbcZ3RoEGioaURp3Gp4axRrsGxQbOxtjG4obshvaHAIcKhxSHHscoxzMHPUdHh1HHXAdmR3DHeweFh5AHmoelB6+HukfEx8+H2kflB+/H+ogFSBBIGwgmCDEIPAhHCFIIXUhoSHOIfsiJyJVIoIiryLdIwojOCNmI5QjwiPwJB8kTSR8JKsk2iUJJTglaCWXJccl9yYnJlcmhya3JugnGCdJJ3onqyfcKA0oPyhxKKIo1CkGKTgpaymdKdAqAio1KmgqmyrPKwIrNitpK50r0SwFLDksbiyiLNctDC1BLXYtqy3hLhYuTC6CLrcu7i8kL1ovkS/HL/4wNTBsMKQw2zESMUoxgjG6MfIyKjJjMpsy1DMNM0YzfzO4M/E0KzRlNJ402DUTNU01hzXCNf02NzZyNq426TckN2A3nDfXOBQ4UDiMOMg5BTlCOX85vDn5OjY6dDqyOu87LTtrO6o76DwnPGU8pDzjPSI9YT2hPeA+ID5gPqA+4D8hP2E/oj/iQCNAZECmQOdBKUFqQaxB7kIwQnJCtUL3QzpDfUPARANER0SKRM5FEkVVRZpF3kYiRmdGq0bwRzVHe0fASAVIS0iRSNdJHUljSalJ8Eo3Sn1KxEsMS1NLmkviTCpMcky6TQJNSk2TTdxOJU5uTrdPAE9JT5NP3VAnUHFQu1EGUVBRm1HmUjFSfFLHUxNTX1OqU/ZUQlSPVNtVKFV1VcJWD1ZcVqlW91dEV5JX4FgvWH1Yy1kaWWlZuFoHWlZaplr1W0VblVvlXDVchlzWXSddeF3JXhpebF69Xw9fYV+zYAVgV2CqYPxhT2GiYfViSWKcYvBjQ2OXY+tkQGSUZOllPWWSZedmPWaSZuhnPWeTZ+loP2iWaOxpQ2maafFqSGqfavdrT2una/9sV2yvbQhtYG25bhJua27Ebx5veG/RcCtwhnDgcTpxlXHwcktypnMBc11zuHQUdHB0zHUodYV14XY+dpt2+HdWd7N4EXhueMx5KnmJeed6RnqlewR7Y3vCfCF8gXzhfUF9oX4BfmJ+wn8jf4R/5YBHgKiBCoFrgc2CMIKSgvSDV4O6hB2EgITjhUeFq4YOhnKG14c7h5+IBIhpiM6JM4mZif6KZIrKizCLlov8jGOMyo0xjZiN/45mjs6PNo+ekAaQbpDWkT+RqJIRknqS45NNk7aUIJSKlPSVX5XJljSWn5cKl3WX4JhMmLiZJJmQmfyaaJrVm0Kbr5wcnImc951kndKeQJ6unx2fi5/6oGmg2KFHobaiJqKWowajdqPmpFakx6U4pammGqaLpv2nbqfgqFKoxKk3qamqHKqPqwKrdavprFys0K1ErbiuLa6hrxavi7AAsHWw6rFgsdayS7LCszizrrQltJy1E7WKtgG2ebbwt2i34LhZuNG5SrnCuju6tbsuu6e8IbybvRW9j74KvoS+/796v/XAcMDswWfB48JfwtvDWMPUxFHEzsVLxcjGRsbDx0HHv8g9yLzJOsm5yjjKt8s2y7bMNcy1zTXNtc42zrbPN8+40DnQutE80b7SP9LB00TTxtRJ1MvVTtXR1lXW2Ndc1+DYZNjo2WzZ8dp22vvbgNwF3IrdEN2W3hzeot8p36/gNuC94UThzOJT4tvjY+Pr5HPk/OWE5g3mlucf56noMui86Ubp0Opb6uXrcOv77IbtEe2c7ijutO9A78zwWPDl8XLx//KM8xnzp/Q09ML1UPXe9m32+/eK+Bn4qPk4+cf6V/rn+3f8B/yY/Sn9uv5L/tz/bf//
     Display0: 1920x1080@60Hz scales:1.000000|1.070000
     Display1: 1920x1080@60Hz scales:1.000000|1.070000
     DisplayCount: 2
     HardwareStretching: both=1 window-only=0 full-screen-only=1 none=0 error=0
     Window Device Pixel Ratios: 1.0714285714285714
     ClearType Parameters: \\.\DISPLAY1 [ Gamma: 1.8 Pixel Structure: RGB ClearType Level: 100 Enhanced Contrast: 50 ] \\.\DISPLAY2 [ Gamma: 1.8 Pixel Structure: RGB ClearType Level: 100 Enhanced Contrast: 50 ]
     WebGPU Default Adapter: [object Object]
     WebGPU Fallback Adapter: [object Object]
     Decision Log
     HW_COMPOSITING: available by defaultblocked by runtime: Acceleration blocked by safe-mode
     D3D11_COMPOSITING: unavailable by default: Hardware compositing is disabled
     DIRECT2D: unavailable by default: Direct2D requires Direct3D 11 compositing
     D3D11_HW_ANGLE: unavailable by default: D3D11 compositing is disableddisabled by env: D3D11 compositing is disabled
     GPU_PROCESS: available by defaultblocked by runtime: Safe-mode is enabled
     WEBRENDER: available by defaultunavailable-in-safe-mode by runtime: Safe-mode is enabled
     WEBRENDER_COMPOSITOR: available by defaultunavailable by runtime: No DirectComposition usage
     WEBRENDER_PARTIAL: available by default
     WEBRENDER_SHADER_CACHE: available by defaultunavailable by runtime: WebRender disabled
     WEBRENDER_OPTIMIZED_SHADERS: available by defaultunavailable by runtime: WebRender disabled
     WEBRENDER_ANGLE: available by defaultunavailable-no-angle by runtime: ANGLE is disabled
     WEBRENDER_DCOMP_PRESENT: available by defaultunavailable by env: Requires GPU processunavailable by runtime: Requires ANGLE
     WEBRENDER_SCISSORED_CACHE_CLEARS: available by default
     WEBGPU: available by defaultblocked by runtime: WebGPU cannot be enabled in release or beta
     WINDOW_OCCLUSION: available by default
     VP8_HW_DECODE: available by default
     VP9_HW_DECODE: available by default
     REUSE_DECODER_DEVICE: available by default
     BACKDROP_FILTER: available by default
     CANVAS_RENDERER_THREAD: available by default
     ACCELERATED_CANVAS2D: disabled by default: Disabled by defaultblocked by env: Disabled by Software WebRender
   Crash Guard Disabled Features
   Workarounds
     Failure Log
     (#0) Error: RenderCompositorSWGL failed mapping default framebuffer, no dt
 Media
     Audio Backend: wasapi
     Max Channels: 2
     Preferred Sample Rate: 44100
     Roundtrip latency (standard deviation): 53.54ms (2.89)
     Output Devices
       Name
       Group
       Vendor
       State
       Preferred
       Format
       Channels
       Rate
       Latency
       BenQ EW2440L (NVIDIA High Definition Audio)
       HDAUDIO\FUNC_01&VEN_10DE&DEV_009F&SUBSYS_1028C974&REV_1001\5&327c1d05&0&0001
       Disabled
       None
       default: F32LE, support: S16LE F32LE
       2
       default: 48000, support: 48000 - 48000
       0 - 0
       Headphones (OpenComm by AfterShokz)
       BTHENUM\{0000110b-0000-1000-8000-00805f9b34fb}_VID&0001000a_PID&ffff\7&12d4d79c&0&2074CF75ABB7_C00000000
       Unplugged
       None
       default: F32LE, support: S16LE F32LE
       2
       default: 44100, support: 44100 - 44100
       0 - 0
       Headset (OpenComm by AfterShokz Hands-Free)
       BTHHFENUM\BthHFPAudio\8&33280891&0&97
       Unplugged
       None
       default: F32LE, support: S16LE F32LE
       1
       default: 8000, support: 8000 - 8000
       0 - 0
       Headphones (Realtek(R) Audio)
       HDAUDIO\FUNC_01&VEN_10EC&DEV_1220&SUBSYS_10280AAC&REV_1001\4&331d8fb5&0&0001
       Enabled
       All
       default: F32LE, support: S16LE F32LE
       2
       default: 44100, support: 44100 - 44100
       133 - 448
       Headphones (2- Sport BH032)
       BTHENUM\{0000110b-0000-1000-8000-00805f9b34fb}_VID&0001000a_PID&ffff\7&12d4d79c&0&1A2F23083625_C00000000
       Unplugged
       None
       default: F32LE, support: S16LE F32LE
       2
       default: 48000, support: 48000 - 48000
       0 - 0
     Input Devices
       Name
       Group
       Vendor
       State
       Preferred
       Format
       Channels
       Rate
       Latency
       Headset (OpenComm by AfterShokz)
       BTHHFENUM\BthHFPAudio\8&33280891&0&97
       Unplugged
       None
       default: F32LE, support: S16LE F32LE
       1
       default: 16000, support: 16000 - 16000
       0 - 0
       Stereo Mix (Realtek(R) Audio)
       HDAUDIO\FUNC_01&VEN_10EC&DEV_1220&SUBSYS_10280AAC&REV_1001\4&331d8fb5&0&0001
       Disabled
       None
       default: F32LE, support: S16LE F32LE
       2
       default: 48000, support: 48000 - 48000
       0 - 0
       Headset (2- Sport BH032)
       BTHHFENUM\BthHFPAudio\8&62b66e3&0&97
       Unplugged
       None
       default: F32LE, support: S16LE F32LE
       1
       default: 16000, support: 16000 - 16000
       0 - 0
       Microphone (HD Pro Webcam C920)
       USB\VID_046D&PID_08E5&MI_02\6&3a1e5d21&0&0002
       Enabled
       All
       default: F32LE, support: S16LE F32LE
       2
       default: 32000, support: 32000 - 32000
       96 - 320
     Media Capabilities
     Enumerate database
 Environment Variables
   MOZ_APP_RESTART: 1
   MOZ_CRASHREPORTER_DATA_DIRECTORY: C:\Users\rus\AppData\Roaming\Thunderbird\Crash Reports
   MOZ_CRASHREPORTER_EVENTS_DIRECTORY: C:\Users\rus\AppData\Roaming\Thunderbird\Profiles\lfwiuj3k.default-release\crashes\events
   MOZ_CRASHREPORTER_PING_DIRECTORY: C:\Users\rus\AppData\Roaming\Thunderbird\Pending Pings
   MOZ_CRASHREPORTER_RESTART_ARG_0: C:\Program Files\Mozilla Thunderbird\thunderbird.exe
   MOZ_CRASHREPORTER_STRINGS_OVERRIDE: C:\Program Files\Mozilla Thunderbird\crashreporter-override.ini
   MOZ_LAUNCHER_PROCESS: 1
 Important Modified Preferences
   browser.search.region: JP
   extensions.lastAppVersion: 115.7.0
   font.name.sans-serif.x-western: Times New Roman
   font.size.variable.x-western: 16
   idle.lastDailyNotification: 1707978902
   media.gmp.storage.version.observed: 1
   media.hardware-video-decoding.failed: true
   places.database.lastMaintenance: 1707767770
   privacy.purge_trackers.date_in_cookie_database: 0
   security.enterprise_roots.enabled: true
   security.sandbox.content.tempDirSuffix: {df95932c-0f56-4a5c-83e8-b2d645050458}
   storage.vacuum.last.content-prefs.sqlite: 1705996709
   storage.vacuum.last.index: 1
   storage.vacuum.last.places.sqlite: 1707767770
   ui.osk.debug.keyboardDisplayReason: IKPOS: Touch screen not found.
 Important Locked Preferences
 fission.autostart.session: true
 Places Database
 Accessibility
   Activated: false
   Prevent Accessibility: 0
   Accessible Handler Used:
   Accessibility Instantiator:
 Library Versions
     Expected minimum version
     Version in use
     NSPR
     4.35
     4.35
     NSS
     3.90.1
     3.90.1
     NSSSMIME
     3.90.1
     3.90.1
     NSSSSL
     3.90.1
     3.90.1
     NSSUTIL
     3.90.1
     3.90.1
 Sandbox
   Content Process Sandbox Level: 0
   Effective Content Process Sandbox Level: 1
   Win32k Lockdown State for Content Process: Win32k Lockdown disabled -- Running in Safe Mode
   GPU Process Sandbox Level: 1
 Startup Cache
   Disk Cache Path: C:\Users\rus\AppData\Local\Thunderbird\Profiles\lfwiuj3k.default-release\startupCache\startupCache.8.little
   Ignore Disk Cache: false
   Found Disk Cache on Init: false
   Wrote to Disk Cache: false
 Internationalization & Localization
     Application Settings
     Requested Locales: ["en-US"]
     Available Locales: ["en-US"]
     App Locales: ["en-US"]
     Regional Preferences: ["en-US"]
     Default Locale: "en-US"
     Operating System
     System Locales: ["en-US","ja-JP"]
     Regional Preferences: ["en-US"]
 Remote Debugging (Chromium Protocol)
   Accepting Connections:
   URL:
 Printing
 Modified print settings
   print_printer: Dell Open Print Driver (PCL XL)
   print.more-settings.open: true
   print.printer_Dell_Open_Print_Driver_(PCL_XL).print_duplex: 1
   print.printer_Dell_Open_Print_Driver_(PCL_XL).print_paper_height: 11.6929133858268
   print.printer_Dell_Open_Print_Driver_(PCL_XL).print_paper_id: 9
   print.printer_Dell_Open_Print_Driver_(PCL_XL).print_paper_size_unit: 0
   print.printer_Dell_Open_Print_Driver_(PCL_XL).print_paper_width: 8.26771653543307
   print.printer_Dell_Open_Print_Driver_(PCL_XL).print_unwriteable_margin_bottom_twips: 360
   print.printer_Dell_Open_Print_Driver_(PCL_XL).print_unwriteable_margin_left_twips: 360
   print.printer_Dell_Open_Print_Driver_(PCL_XL).print_unwriteable_margin_right_twips: 360
   print.printer_Dell_Open_Print_Driver_(PCL_XL).print_unwriteable_margin_top_twips: 360

Asked by rus15 2 months ago

emails with same date arriving on different days

For more than a month, each day when get my emails from my Comcast account, one or more (usually more) of the messages is dated 1/8/2024 and displays the time 6:58 AM. To… (read more)

For more than a month, each day when get my emails from my Comcast account, one or more (usually more) of the messages is dated 1/8/2024 and displays the time 6:58 AM. Today I got 6 more. At first, I just deleted them. Then I saved several in a folder and looked at the sender addresses. There were lots of different addresses but, also, some of the addresses were the source of more than one email. I plan on creating a filter to junk any future ones as they come in. I’m posting this primarily out of curiosity. Does someone have an idea of what’s happening? Of what’s causing this 1/8/2024 happening? Thanks.

Asked by I_Rufus 2 months ago