All Products Support Forum

Greetings. so I have been using this type of browser since netscape vs ie. enjoy and use firefox daily, when i can. there seems to be a weird process of constantly changing the software, and not allowing reliability. I can set for no updates, or only if i allow it, but firefox ignores me and updates anyway and then displays a new front page describing the mischief the coders have been up to. couple weeks ago, you broke it. dead. like a brick. switched to brave, there were a couple updates, you undid whatever you broke, fine. then a day or two ago, broke it again. not really a fun game. once i am able to move bookmarks over to brave, why do firefox? it takes forever to start, presumably while it sends all my browsing history and downloads to be examined for commercial potential. I can give fire fox a 2 or 3 minute headstart, hit brave, in 10 seconds i can use it, firefox still busy with industrial spying, or something. eating a sandwich? who knows. if there is any way to tell the coders to create a do not change, leave my damn browser alone because it works button, that would be nice. otherwise, its just a weird game for someone i guess, but i dont have time to play.....

This AM, I opened my Firefox Browser for the first time today and attempted to sign into my EaseUS account. I was confronted by a "request" to add "Browsing Safety by Safely" as an add-on to my Firefox. However, it would not let me to skip this "request" without adding it to Firefox. Nothing I attempted worked. I've never heard of a compulsory add-on, least of all from Mozilla! If I would have had the time, I'd have tried different accounts/log-ons/browsers, etc. However, I didn't have the time to do it then. Help please.

What is this? Have you heard of it? Do I have a problem? Should I remove the Add-On?

Thank you.

Harris [email address]

(email address removed; please do not post personal information on a public website; Forum rules and guidelines)

I receive gmail using Thunderbird version 115.7.0

When I open an email from another gmail account with image attachment, it only shows the file name. Example 'image.jpg' but not download or open option for the file.

Problem solved when I changed Message Body from 'Original HTML' to 'Plain Text'.

It's this normal? Is it a problem caused by the sender? Or it there a better way I can handle this at my end?

I need to run speech recognition in Firefox (OS solutions are not suitable in my case), but I can't get it to work. I've tried following these instructions in Nightly, Dev and regular version, but they all end with a network error. I also asked my friends to check and they had the same thing happen. Do I need to follow the steps to run offline or is the problem much deeper?

Firefox Dev 124.0b2 (64-bit) Firefox Nightly 125.0a1 (2024-02-22) (64-bit)

Most of my email message filters do not run automatically but will run correctly manually. I am running Thunderbird 115.8.0 (64-bit) on Windows 10. I have 65 filters defined.

I have tried repairing the folders. I have even deleted the old folders and created a new folder. I deleted and recreated all of the .msf files. I have insured that the filer criteria is defined correctly (i.e. multiple condition are "match any", "contains", etc). These efforts have not corrected the problem.

This problem has been around for quite some time. Is there a plan to correct the problem or provide a newer version of message filters that works correctly.

Below is a copy of one of the Filter Log entries of an automatic filter failure. I have included the log entry of the filer being run manually following the failure entry. I have included a screenshot of the pertinent rule:

[2/22/2024, 2:23:55 PM] Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel

[2/22/2024, 2:23:56 PM] Filter action failed: "Move failed" with error code=0x8055000f while attempting: Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel

[2/22/2024, 2:23:56 PM] Filter action failed: "Failed applying the filter action" with error code=0x8055000f while attempting: Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel

[2/22/2024, 2:23:56 PM] Message from filter "From contains: intel.com": Applying filter actions failed

[2/22/2024, 2:23:56 PM] Filter run failed

Manual filter run log entry:

[2/22/2024, 3:15:31 PM] Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel

I have a problem. When I access my Firefox main default screen I open up a respective website I want to access but within a matter of a few seconds the main default screen automatically opens up again meaning I now have two windows open which shouldn’t happen! I have opened up ‘Help’ and have refreshed Firefox a few times now. Additionally, I have opened ‘Troubleshooting Mode’ which comes up with ‘Restart’ then ‘Open’ and I have ‘Refreshed Firefox’ from this option. I have cleared my Cookies and Cache. I asked for help through the Firefox Community. I received one response asking if the problem still happened in ‘Troubleshooting Mode’. My response 'yes' it does but I have not had any other reply. Hence, I am stuck. Nothing has worked which I find very frustrating. I have used Firefox for many years now but if I cannot resolve this matter I will have to select a different browser which I don’t really want to do.

I'm using a Hotspot provided by Cisco in a library and when first connecting to the Wireless network, Firefox prompts me to login to network in order to have Internet access (expected and works fine). However, once the time session expires Firefox will sometimes prompt again to login. When this fails and internet access is abruptly ended, I've to reconnect to the Wireless network and have Firefox prompt to login.

This is a security vulnerability as someone could advertise the BSSID of the router and have victims connect to their Hotspot instead of the true one.

The inbox listings move once an email is selected. This began upon an upgrade to Debian 11 which included an upgrade to Thunderbird. I had the same issue with an upgrade to Antix 21 recently. That issue was resolved with another upgrade to Thunderbird about a week later.

Hi,

During of build process we have an error related to auto deduction before 'auto' in dom/bindings/TypedArray.h

For example the call ProcessTypedArrays() at line 128 in file ChromeUtils.cpp give the error.

Is there a way to rename things in the Passwords list? I'm not concerned about MY password or sign-in, but what appears in the list. A name such as "login.live.com" tells me nothing about what site that sign-in will take me to. I'd like to be able to rename it with something that gives me a hint.

I have a fairly long list of saved logins, and visually scan the list at times to get to a supplier or service I need.

I'm using a desktop, Windows 10.

Thanks.

Sometimes I can see folders. Other times I can't. And I can't figure out how to change the view. When I search help I get 1384 hits. Clicking on folders in Thunderbird does nothing.

Dear Mozilla Team,

using Thunderbird I encountered a new problem regarding my Microsoft live.com account. I've had problems logging in, I'm asked for a new password. I've seen that this here seems to be the problem (and solution): https://support.mozilla.org/en-US/kb/microsoft-oauth-authentication-and-thunderbird-202

I've then tried to follow the directions given in the article. However, I cannot change my outgoing smtp settings to Oauth2 (it only gives the options "password, normal", "password, encrypted", "Kerberos", "NTLM" and "No Authentification").

Now, I am not asked for new login data, but my mails do not appear either. It appears, that there is now no successful connection to the server (it keeps getting stuck contacting the host and sending login data; see image attached - in german).

Is there any fix to this?

Best Niklas

Recently my browser stopped opening in full screen. It opens in a little box that is usually partially off screen. I have not changed any settings and do not understand why this is happening. I maximize the window which usually has to be done twice (meaning I hit the maximize window twice to get it to go completely back to full screen). I have also tried dragging the corners of the window to maximum size, but the following day it will go back to not opening in full screen. If someone could help me with this, I would really appreciate it.

1.Running Thunderbird 115.6.0 64 bit on Windows 10. 2.Using Microsoft Defender as AntiVirus and I set Thunderbird profile folder to be excluded from AV. 3.Getting emails from a single Earthlink pop server account. Problem: When clicking Get Messages it works great except yesterday there was one single email on the pop server that would not download properly. It prevented all subsequent messages from downloading. It is a valid email and is not spam. When I searched for the message, it showed multiple times (about 50) in the Thunderbird Inbox. When I deleted the email from the pop server, everything works again. What is there about this messages that causes it to lockup the get message process? Thanks for your help, John

Here is the problem email header: Authentication-Results:mail142c38.carrierzone.com; spf=pass smtp.mailfrom=bankhometown.com Content-Transfer-Encoding:8bit Content-Type:text/plain; charset=us-ascii Date:16 Feb 2024 23:37:56 -0500 Dmarc-Filter:OpenDMARC Filter v1.4.1 mail142c38.carrierzone.com 41H4bxPb013175 From:PPDONOTREPLY@bankhometown.com Message-ID:<3w65bxfyau-1@ppt-gw2.cocci.com> Mime-Version:1.0 Received:from ext-smtp.cocci.com (mail-ext01.cocci.com [204.60.84.37]) by mail142c38.carrierzone.com (8.14.9/8.13.1) with ESMTP id 41H4bxPb013175 for <lisa@bcscompany.com>; Fri, 16 Feb 2024 23:38:02 -0500 Received-Spf:pass (mail142c38.carrierzone.com: domain of ppdonotreply@bankhometown.com designates 204.60.84.37 as permitted sender) receiver=mail142c38.carrierzone.com; client-ip=204.60.84.37; helo=ext-smtp.cocci.com; envelope-from=ppdonotreply@bankhometown.com; x-software=spfmilter 2.001 http://www.acme.com/software/spfmilter/ with libspf2-1.2.10; Return-Path:<ppdonotreply@bankhometown.com> Subject:Positive Pay System Notifications To:lisa@bcscompany.com X-Cocc-Mailscanner:Not scanned: please contact your Internet E-Mail Service Provider for details X-Cocc-Mailscanner-Information:Please contact the ISP for more information X-Cocc-Msgid:DB8A556B4.A1271 X-Da-Pass:W0T0 X-Envelope-From:ppdonotreply@bankhometown.com X-Mime-Autoconverted:from quoted-printable to 8bit by mail142c38.carrierzone.com id 41H4bxPb013175 X-Origin-Country:US X-Spam-Flag:NO X-Vade-Spamcause:gggruggvucftvghtrhhoucdtuddrgedvledrvdefgdejvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffuvffqrffktedpgffpggdqveefkeenuceurghilhhouhhtmecufedtudenucenucfjughrpegghffvfffutgfgkfesthhqredttddtvdenucfhrhhomheprffrfffqpffqvfftgffrnfgjsegsrghnkhhhohhmvghtohifnhdrtghomhenucggtffrrghtthgvrhhnpeekjeehieetvefftedvheekhedvudetffeufeehveejjeetvdfhteegffevleduudenucfkphepvddtgedriedtrdekgedrfeejnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtgedriedtrdekgedrfeejpdhhvghlohepvgigthdqshhmthhprdgtohgttghirdgtohhmpdhmrghilhhfrhhomhepphhpughonhhothhrvghplhihsegsrghnkhhhohhmvghtohifnhdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehlihhsrgessggtshgtohhmphgrnhihrdgtohhm X-Vade-Spamscore:0 X-Vade-Spamstate:clean X-Whl:LR

I've been trying to reply to moderator "Phil" who requested information regarding Firefox crashing while on Youtube. When I press "Post reply" all I get is an error message:

An Error Occurred

Oh, no! It looks like an unexpected error occurred. We've already notified the site administrators. Please try again now, or in a few minutes.

It's important "Phil" gets my message as others may be affected my possible Youtube shenanigans. If possible, can you forward this message to "Phil": Unfortunately there are only two reports generated during the problems with Youtube:

bp-91f496a8-971c-4a87-a642-011d10240220 bp-7d820f6c-dcf9-4cef-bb60-1a9f50240217

The problem caused my system to stop responding forcing me to power cycle to clear my PC, so no reports could be generated. Hopefully these two will show what the problem is. In the meantime, can you check the reply system to make certain it's working properly?