Thunderbird Forum podrške

Thunderbird trying to download email from POP3 BELLSOUTH.NET server. The downloads are set for 1 minute they stopped happening mid-January on the PC. These downloads continue to work successfully on the Android c-phone. What do you suggest?

Thank you, George W

Hi,

I recently installed a CalDAV server at my workplace to connect to in the Thunderbird calendar, as we all already use Thunderbird for e-mail.

If I create a meeting in the calendar and invite everyone else, they all get an email invite with the name, time & place of meeting etc.. And at the top of the email, just below the title of the email, there is a purple bar with boxes saying "Accept", "Tentative", "Deny" and "More" (or something synonymous, I have it in Swedish).

For one employee that purple bar with the "Accept"-box does not appear, and the only way for him to get the meeting to his calendar is by downloading the "invite.ics" file that is attached and importing it afterwards.

I have added two screenshots showing what I mean. One with the Accept, Deny etc. and the one person's e-mail that doesn't have the boxes.

We have checked his settings without finding anything that seems wrong in first glance. I have checked the caldav user account but the user account has the same settings as the others. Thunderbird is updated to the latest version (115.7.0, same as I use and it works for me).

When he invites people to a meeting they all get the invite correctly, so nothing is wrong when he creates a meeting invitation, only when he recieves an invite.

What could be wrong? Is there a setting he might've activated/deactivated in Thunderbird that we missed when looking or could there be something else we have thought of?

Thanks, Tim

Twice withing the past 4/5 days I have (purely by chance) noticed an email - for which I had been waiting - on the list of five messages. (bottom right corner) waiting to be added to my inbox. When I went to read the messages only four new ones were there - the one I was waiting for, seen on the 'about to be downloaded' list - was missing. My wife informed me that she had experience a similar problem, eventually solved by locating the email furthe back in history, now attached to another email, and identified by some unexplained arrows. I went in search of similar arrows and found my missing email now attached to an earlier title.

What on earth is the purpose of this? If I hadn't spotted the email as I did and as it didn't appear as a recent addition in the inbox, I could not have known it had been sent to me. After the glimpse l'd had of if I emailed the sender to check that he'd sent it. He was puzzled as to why I hadn't replied.

I'm a long way from being an expert - scarcely competent in fact - in computing matters, but I am capable of filing my own mail. Please can Thunderbird leave it to me in future?

In addition to what's in the Subject field, I can "bring back" the hidden emails sooner by clicking another folder, then click back on the folder whose emails disappear (awaiting thermometer). This happens for more than one e-ddress, and also happens when I have a tab open to a given email and press Del.

This doesn't ALWAYS happen, but enough that it's annoying. Anyone else experience this?

Regards, Dave

Hello,

Similarly to user that asked https://support.mozilla.org/en-US/questions/1376333, I would like to know if an accepted event can be edited – really edited, not just by converting/duplicating it to a task or another event.

For example, if I added an accepted invite to the wrong calendar and would like to move it to another one of my calendars... This calendar switching feature is part of MacOS Calendar, even if, as in Thunderbird, other properties of an accepted invite are not editable (except for comments).

Since this lack of control over invite edition is mainly what is holding me to adopt Thunderbird, is such a feature likely to be deployed eventually?

Regards,

I'm running latest Thunderbird and Windows 10, both up to date

Email reply is not in the Thunderbird sent folder but it is in the BT mail sent folder

Searching Thunderbird finds the email and viewing as list shows location as Sent Checking on laptop running windows 11 gives same result

Suggestions please

1.Running Thunderbird 115.6.0 64 bit on Windows 10. 2.Using Microsoft Defender as AntiVirus and I set Thunderbird profile folder to be excluded from AV. 3.Getting emails from a single Earthlink pop server account. Problem: When clicking Get Messages it works great except yesterday there was one single email on the pop server that would not download properly. It prevented all subsequent messages from downloading. It is a valid email and is not spam. When I searched for the message, it showed multiple times (about 50) in the Thunderbird Inbox. When I deleted the email from the pop server, everything works again. What is there about this messages that causes it to lockup the get message process? Thanks for your help, John

Here is the problem email header: Authentication-Results:mail142c38.carrierzone.com; spf=pass smtp.mailfrom=bankhometown.com Content-Transfer-Encoding:8bit Content-Type:text/plain; charset=us-ascii Date:16 Feb 2024 23:37:56 -0500 Dmarc-Filter:OpenDMARC Filter v1.4.1 mail142c38.carrierzone.com 41H4bxPb013175 From:PPDONOTREPLY@bankhometown.com Message-ID:<3w65bxfyau-1@ppt-gw2.cocci.com> Mime-Version:1.0 Received:from ext-smtp.cocci.com (mail-ext01.cocci.com [204.60.84.37]) by mail142c38.carrierzone.com (8.14.9/8.13.1) with ESMTP id 41H4bxPb013175 for <lisa@bcscompany.com>; Fri, 16 Feb 2024 23:38:02 -0500 Received-Spf:pass (mail142c38.carrierzone.com: domain of ppdonotreply@bankhometown.com designates 204.60.84.37 as permitted sender) receiver=mail142c38.carrierzone.com; client-ip=204.60.84.37; helo=ext-smtp.cocci.com; envelope-from=ppdonotreply@bankhometown.com; x-software=spfmilter 2.001 http://www.acme.com/software/spfmilter/ with libspf2-1.2.10; Return-Path:<ppdonotreply@bankhometown.com> Subject:Positive Pay System Notifications To:lisa@bcscompany.com X-Cocc-Mailscanner:Not scanned: please contact your Internet E-Mail Service Provider for details X-Cocc-Mailscanner-Information:Please contact the ISP for more information X-Cocc-Msgid:DB8A556B4.A1271 X-Da-Pass:W0T0 X-Envelope-From:ppdonotreply@bankhometown.com X-Mime-Autoconverted:from quoted-printable to 8bit by mail142c38.carrierzone.com id 41H4bxPb013175 X-Origin-Country:US X-Spam-Flag:NO X-Vade-Spamcause:gggruggvucftvghtrhhoucdtuddrgedvledrvdefgdejvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffuvffqrffktedpgffpggdqveefkeenuceurghilhhouhhtmecufedtudenucenucfjughrpegghffvfffutgfgkfesthhqredttddtvdenucfhrhhomheprffrfffqpffqvfftgffrnfgjsegsrghnkhhhohhmvghtohifnhdrtghomhenucggtffrrghtthgvrhhnpeekjeehieetvefftedvheekhedvudetffeufeehveejjeetvdfhteegffevleduudenucfkphepvddtgedriedtrdekgedrfeejnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtgedriedtrdekgedrfeejpdhhvghlohepvgigthdqshhmthhprdgtohgttghirdgtohhmpdhmrghilhhfrhhomhepphhpughonhhothhrvghplhihsegsrghnkhhhohhmvghtohifnhdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehlihhsrgessggtshgtohhmphgrnhihrdgtohhm X-Vade-Spamscore:0 X-Vade-Spamstate:clean X-Whl:LR

This happened both on my old install of macOS Ventura as well as a clean fresh install of macOS Sonoma: When I open Thunderbird, it beachballs (is unresponsive, shows macOS beachball, fan ramps up) for anywhere between 5-25 seconds. This only happens when an account is set up, if I delete the account, Thunderbird starts quickly again. This happens with accounts from different providers.

Details: 115.7.0 (64-Bit) (happened with older versions as well) 2019 16" MacBook Pro 2,3 GHz 8 Core i9 32GB Memory 1TB Storage macOS Sonoma 14.3.1 (happened with Ventura as well)

When I attempt to retrieve mail (from some accounts) I receive the error message "account being processed, please wait until completion to download the messages" (see att.). Even after a long time (hours) the same happens - so I have to use my phone or IMAPS to get my messages. This happens only since I upgraded to Supernova (currently 115.7.0) and apparently on mail server orange.fr (but not all my mail accounts on orange.fr). I did not change (manually) any setting. Other mail servers (including wanadoo.fr which is an orange.fr mail server) seem to work ok. Thanks for any help & BR Max.

Dear Mozilla Team,

using Thunderbird I encountered a new problem regarding my Microsoft live.com account. I've had problems logging in, I'm asked for a new password. I've seen that this here seems to be the problem (and solution): https://support.mozilla.org/en-US/kb/microsoft-oauth-authentication-and-thunderbird-202

I've then tried to follow the directions given in the article. However, I cannot change my outgoing smtp settings to Oauth2 (it only gives the options "password, normal", "password, encrypted", "Kerberos", "NTLM" and "No Authentification").

Now, I am not asked for new login data, but my mails do not appear either. It appears, that there is now no successful connection to the server (it keeps getting stuck contacting the host and sending login data; see image attached - in german).

Is there any fix to this?

Best Niklas

Hello all,

I haven't opened my email-client Tunderbird since 13.07.2023. I've opened it today and due to automatic downloading with start, it downloaded nearyl 2200 emails.

But they don't appear in my inbox. I can't find them via search. Due to automatical deletion via smtp they're not in my email account anymore.

Can you please help fixing this issue?

BR Thiemo Neumann

I am trying to move back to Thunderbird from Apple Mail. The issue I am having is that Thunderbird is not pulling my sent messages on my Mac or in Linux. When I used Thunderbird in the past this was not an issue. I checked the forum and my iCloud and Fastmail accounts are set up as IMAP. What has me confused is that Thunderbird pulled three messages with very old dates but nothing else.

I receive gmail using Thunderbird version 115.7.0

When I open an email from another gmail account with image attachment, it only shows the file name. Example 'image.jpg' but not download or open option for the file.

Problem solved when I changed Message Body from 'Original HTML' to 'Plain Text'.

It's this normal? Is it a problem caused by the sender? Or it there a better way I can handle this at my end?

After some moment thunderbird cant receive sended emails from server. Its downloading messages and after that, when im trying to open a blank message the new is arriving. I was trying to "repair" folder and also completely reintstall thunderbird - nothing changed. Could someone give an advise how to solve this?

I use Thunderbird 115.8.0 (64-bit) on Windows to check 10 email accounts all on the same server. The setup in Tbird for all accounts is identical. I only have a problem with one account.

The problem is that on one account, after a small number of replies on a thread, the Send button becomes greyed out and emails will not save.

The other email accounts continue to work just fine.

Compacting mailboxes does not fix the issue.

The inbox listings move once an email is selected. This began upon an upgrade to Debian 11 which included an upgrade to Thunderbird. I had the same issue with an upgrade to Antix 21 recently. That issue was resolved with another upgrade to Thunderbird about a week later.

Sometimes I can see folders. Other times I can't. And I can't figure out how to change the view. When I search help I get 1384 hits. Clicking on folders in Thunderbird does nothing.

Most of my email message filters do not run automatically but will run correctly manually. I am running Thunderbird 115.8.0 (64-bit) on Windows 10. I have 65 filters defined.

I have tried repairing the folders. I have even deleted the old folders and created a new folder. I deleted and recreated all of the .msf files. I have insured that the filer criteria is defined correctly (i.e. multiple condition are "match any", "contains", etc). These efforts have not corrected the problem.

This problem has been around for quite some time. Is there a plan to correct the problem or provide a newer version of message filters that works correctly.

Below is a copy of one of the Filter Log entries of an automatic filter failure. I have included the log entry of the filer being run manually following the failure entry. I have included a screenshot of the pertinent rule:

[2/22/2024, 2:23:55 PM] Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel

[2/22/2024, 2:23:56 PM] Filter action failed: "Move failed" with error code=0x8055000f while attempting: Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel

[2/22/2024, 2:23:56 PM] Filter action failed: "Failed applying the filter action" with error code=0x8055000f while attempting: Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel

[2/22/2024, 2:23:56 PM] Message from filter "From contains: intel.com": Applying filter actions failed

[2/22/2024, 2:23:56 PM] Filter run failed

Manual filter run log entry:

[2/22/2024, 3:15:31 PM] Applied filter "From contains: intel.com" to message from Intel Software <softwareproductssvcs@plan.intel.com> - [Feb 28 Session] Next-level CUDA-to-SYCL optimizations at 2/21/2024, 3:08:09 PM moved message id = cba06e5df88c458ea0b4d9df36f85bfa@334284386 to mailbox://pej%40fmi-usa.com@outlook.office365.com/purchases/Intel

A week or so ago I patched Thunderbird (115.8.0 (64-bit)). Everything seemed fine and I proceeded to empty the TRASH. It took an unusually long time to delete the roughly 175 messages in the TRASH. Then the screen "blinked" and when Thunderbird reappeared the SENT fold, while present, showed that it contained NO emails. I have sent about 50 emails since this occurred and the counter on the SENT folder continues to show the the folder contains no emails.

Does anyone have any suggestions as to how I can get things to work again?