Svi proizvodi Forum podrške

Hi there,

I am a fan of Firfox Browser in PC but on mobile i have issue of private browsing not function normally. I search a query in private browsing tab its response back with relevant pages if i click on any response it immediately open that link in normal tab i have attached screen short for your reference. I am feel free to give any relevant information required for u. I hope you will address this issue soon

Thank you.

1.Running Thunderbird 115.6.0 64 bit on Windows 10. 2.Using Microsoft Defender as AntiVirus and I set Thunderbird profile folder to be excluded from AV. 3.Getting emails from a single Earthlink pop server account. Problem: When clicking Get Messages it works great except yesterday there was one single email on the pop server that would not download properly. It prevented all subsequent messages from downloading. It is a valid email and is not spam. When I searched for the message, it showed multiple times (about 50) in the Thunderbird Inbox. When I deleted the email from the pop server, everything works again. What is there about this messages that causes it to lockup the get message process? Thanks for your help, John

Here is the problem email header: Authentication-Results:mail142c38.carrierzone.com; spf=pass smtp.mailfrom=bankhometown.com Content-Transfer-Encoding:8bit Content-Type:text/plain; charset=us-ascii Date:16 Feb 2024 23:37:56 -0500 Dmarc-Filter:OpenDMARC Filter v1.4.1 mail142c38.carrierzone.com 41H4bxPb013175 From:PPDONOTREPLY@bankhometown.com Message-ID:<3w65bxfyau-1@ppt-gw2.cocci.com> Mime-Version:1.0 Received:from ext-smtp.cocci.com (mail-ext01.cocci.com [204.60.84.37]) by mail142c38.carrierzone.com (8.14.9/8.13.1) with ESMTP id 41H4bxPb013175 for <lisa@bcscompany.com>; Fri, 16 Feb 2024 23:38:02 -0500 Received-Spf:pass (mail142c38.carrierzone.com: domain of ppdonotreply@bankhometown.com designates 204.60.84.37 as permitted sender) receiver=mail142c38.carrierzone.com; client-ip=204.60.84.37; helo=ext-smtp.cocci.com; envelope-from=ppdonotreply@bankhometown.com; x-software=spfmilter 2.001 http://www.acme.com/software/spfmilter/ with libspf2-1.2.10; Return-Path:<ppdonotreply@bankhometown.com> Subject:Positive Pay System Notifications To:lisa@bcscompany.com X-Cocc-Mailscanner:Not scanned: please contact your Internet E-Mail Service Provider for details X-Cocc-Mailscanner-Information:Please contact the ISP for more information X-Cocc-Msgid:DB8A556B4.A1271 X-Da-Pass:W0T0 X-Envelope-From:ppdonotreply@bankhometown.com X-Mime-Autoconverted:from quoted-printable to 8bit by mail142c38.carrierzone.com id 41H4bxPb013175 X-Origin-Country:US X-Spam-Flag:NO X-Vade-Spamcause:gggruggvucftvghtrhhoucdtuddrgedvledrvdefgdejvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffuvffqrffktedpgffpggdqveefkeenuceurghilhhouhhtmecufedtudenucenucfjughrpegghffvfffutgfgkfesthhqredttddtvdenucfhrhhomheprffrfffqpffqvfftgffrnfgjsegsrghnkhhhohhmvghtohifnhdrtghomhenucggtffrrghtthgvrhhnpeekjeehieetvefftedvheekhedvudetffeufeehveejjeetvdfhteegffevleduudenucfkphepvddtgedriedtrdekgedrfeejnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtgedriedtrdekgedrfeejpdhhvghlohepvgigthdqshhmthhprdgtohgttghirdgtohhmpdhmrghilhhfrhhomhepphhpughonhhothhrvghplhihsegsrghnkhhhohhmvghtohifnhdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehlihhsrgessggtshgtohhmphgrnhihrdgtohhm X-Vade-Spamscore:0 X-Vade-Spamstate:clean X-Whl:LR

Hi, I would like to eliminate table borders when I reply to a message, or when I forward it. I have tried putting some css code in UserContent.css. For example for "blockquote[type="cite"] table" I use !important. But the borders always remain. Which tag can I use to get border: none ?

Recently my browser stopped opening in full screen. It opens in a little box that is usually partially off screen. I have not changed any settings and do not understand why this is happening. I maximize the window which usually has to be done twice (meaning I hit the maximize window twice to get it to go completely back to full screen). I have also tried dragging the corners of the window to maximum size, but the following day it will go back to not opening in full screen. If someone could help me with this, I would really appreciate it.

For more than a month, each day when get my emails from my Comcast account, one or more (usually more) of the messages is dated 1/8/2024 and displays the time 6:58 AM. Today I got 6 more. At first, I just deleted them. Then I saved several in a folder and looked at the sender addresses. There were lots of different addresses but, also, some of the addresses were the source of more than one email. I plan on creating a filter to junk any future ones as they come in. I’m posting this primarily out of curiosity. Does someone have an idea of what’s happening? Of what’s causing this 1/8/2024 happening? Thanks.

In addition to what's in the Subject field, I can "bring back" the hidden emails sooner by clicking another folder, then click back on the folder whose emails disappear (awaiting thermometer). This happens for more than one e-ddress, and also happens when I have a tab open to a given email and press Del.

This doesn't ALWAYS happen, but enough that it's annoying. Anyone else experience this?

Regards, Dave

After facebook messenger upgraded their security chat with end to end encryption call/video is not possible in firefox. Call/video buttons even disappeared. However i can call from microsoft edge web browser for example. Is this some kind of bug with mozilla? Anyone have experienced this too?

I've read all of the recommendation on how to keep links from opening in another window. Tried them all to no avail. This is a new problem. Anybody out there finding the same issue? Find a fix?

Hi jscher2000,

my apologies for creating again a new question: still being unable to reply directly due to the "unexpected error" message.

Thank you very much for your prompt reply.

Yes, following your instructions I now can see and access the attachements. I cannot still opening them, only download them. It is not perfect but at least I can have access to the attachments without having to exit Firefox and go to Acrobat.

Thanks again!.

I have a problem. When I access my Firefox main default screen I open up a respective website I want to access but within a matter of a few seconds the main default screen automatically opens up again meaning I now have two windows open which shouldn’t happen! I have opened up ‘Help’ and have refreshed Firefox a few times now. Additionally, I have opened ‘Troubleshooting Mode’ which comes up with ‘Restart’ then ‘Open’ and I have ‘Refreshed Firefox’ from this option. I have cleared my Cookies and Cache. I asked for help through the Firefox Community. I received one response asking if the problem still happened in ‘Troubleshooting Mode’. My response 'yes' it does but I have not had any other reply. Hence, I am stuck. Nothing has worked which I find very frustrating. I have used Firefox for many years now but if I cannot resolve this matter I will have to select a different browser which I don’t really want to do.

Hi,

What is the area above toolbox called (Firefox, File, Edit, View, History, Bookmarks, Tools, Window, Help) and how do I change color on just that?

Thank You, Leslie

I last updated Firefox on Feb 5, and had Ublock, Privacy Badger, and Search by Image we add-ons. Tonight, just randomly, I noticed that typed text wasn't appearing in the text box (although the suggestions showed up in the keyboard) at all on every webpage and site.

Uninstalling and reinstalling (along with the add-ons) did the trick. I am really curious what the root cause was. Hopefully nothing sinister.

I'm on a TCL 30XE 5G running Android 12.

I noticed the mozilla.org website has a new favicon. I feel like that sort of thing usually alludes to some forthcoming development. Hmm...

My question is. Hmm? I wonder what's going on over at Mozilla.

How can I synchronize my address book across my devices running Thunderbird? I had an app called ZZAddresses that worked well for 10 years or so, until it quit. Does anybody know what happened to it, or what I can use instead? Is Tbird's promised synchronizer going to be real?