Need help
I get notifications on my lock screen on my phone , but when I click on it the app opens up to the home screen not the notification .
I get notifications on my lock screen on my phone , but when I click on it the app opens up to the home screen not the notification .
1.Running Thunderbird 115.6.0 64 bit on Windows 10. 2.Using Microsoft Defender as AntiVirus and I set Thunderbird profile folder to be excluded from AV. 3.Getting emails … (funda kabanzi)
1.Running Thunderbird 115.6.0 64 bit on Windows 10. 2.Using Microsoft Defender as AntiVirus and I set Thunderbird profile folder to be excluded from AV. 3.Getting emails from a single Earthlink pop server account. Problem: When clicking Get Messages it works great except yesterday there was one single email on the pop server that would not download properly. It prevented all subsequent messages from downloading. It is a valid email and is not spam. When I searched for the message, it showed multiple times (about 50) in the Thunderbird Inbox. When I deleted the email from the pop server, everything works again. What is there about this messages that causes it to lockup the get message process? Thanks for your help, John
Here is the problem email header: Authentication-Results:mail142c38.carrierzone.com; spf=pass smtp.mailfrom=bankhometown.com Content-Transfer-Encoding:8bit Content-Type:text/plain; charset=us-ascii Date:16 Feb 2024 23:37:56 -0500 Dmarc-Filter:OpenDMARC Filter v1.4.1 mail142c38.carrierzone.com 41H4bxPb013175 From:PPDONOTREPLY@bankhometown.com Message-ID:<3w65bxfyau-1@ppt-gw2.cocci.com> Mime-Version:1.0 Received:from ext-smtp.cocci.com (mail-ext01.cocci.com [204.60.84.37]) by mail142c38.carrierzone.com (8.14.9/8.13.1) with ESMTP id 41H4bxPb013175 for <lisa@bcscompany.com>; Fri, 16 Feb 2024 23:38:02 -0500 Received-Spf:pass (mail142c38.carrierzone.com: domain of ppdonotreply@bankhometown.com designates 204.60.84.37 as permitted sender) receiver=mail142c38.carrierzone.com; client-ip=204.60.84.37; helo=ext-smtp.cocci.com; envelope-from=ppdonotreply@bankhometown.com; x-software=spfmilter 2.001 http://www.acme.com/software/spfmilter/ with libspf2-1.2.10; Return-Path:<ppdonotreply@bankhometown.com> Subject:Positive Pay System Notifications To:lisa@bcscompany.com X-Cocc-Mailscanner:Not scanned: please contact your Internet E-Mail Service Provider for details X-Cocc-Mailscanner-Information:Please contact the ISP for more information X-Cocc-Msgid:DB8A556B4.A1271 X-Da-Pass:W0T0 X-Envelope-From:ppdonotreply@bankhometown.com X-Mime-Autoconverted:from quoted-printable to 8bit by mail142c38.carrierzone.com id 41H4bxPb013175 X-Origin-Country:US X-Spam-Flag:NO X-Vade-Spamcause:gggruggvucftvghtrhhoucdtuddrgedvledrvdefgdejvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffuvffqrffktedpgffpggdqveefkeenuceurghilhhouhhtmecufedtudenucenucfjughrpegghffvfffutgfgkfesthhqredttddtvdenucfhrhhomheprffrfffqpffqvfftgffrnfgjsegsrghnkhhhohhmvghtohifnhdrtghomhenucggtffrrghtthgvrhhnpeekjeehieetvefftedvheekhedvudetffeufeehveejjeetvdfhteegffevleduudenucfkphepvddtgedriedtrdekgedrfeejnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtgedriedtrdekgedrfeejpdhhvghlohepvgigthdqshhmthhprdgtohgttghirdgtohhmpdhmrghilhhfrhhomhepphhpughonhhothhrvghplhihsegsrghnkhhhohhmvghtohifnhdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehlihhsrgessggtshgtohhmphgrnhihrdgtohhm X-Vade-Spamscore:0 X-Vade-Spamstate:clean X-Whl:LR
Error Language: Deutsch (German) is incompatible with Firefox 123.0. It`´s not possible to switch to german language on this version. You forget the germans.
I've been trying to reply to moderator "Phil" who requested information regarding Firefox crashing while on Youtube. When I press "Post reply" all I get is an error messa… (funda kabanzi)
I've been trying to reply to moderator "Phil" who requested information regarding Firefox crashing while on Youtube. When I press "Post reply" all I get is an error message:
An Error Occurred
Oh, no! It looks like an unexpected error occurred. We've already notified the site administrators. Please try again now, or in a few minutes.
It's important "Phil" gets my message as others may be affected my possible Youtube shenanigans. If possible, can you forward this message to "Phil": Unfortunately there are only two reports generated during the problems with Youtube:
bp-91f496a8-971c-4a87-a642-011d10240220 bp-7d820f6c-dcf9-4cef-bb60-1a9f50240217
The problem caused my system to stop responding forcing me to power cycle to clear my PC, so no reports could be generated. Hopefully these two will show what the problem is. In the meantime, can you check the reply system to make certain it's working properly?
The inbox listings move once an email is selected. This began upon an upgrade to Debian 11 which included an upgrade to Thunderbird. I had the same issue with an upgrade … (funda kabanzi)
The inbox listings move once an email is selected. This began upon an upgrade to Debian 11 which included an upgrade to Thunderbird. I had the same issue with an upgrade to Antix 21 recently. That issue was resolved with another upgrade to Thunderbird about a week later.
I receive gmail using Thunderbird version 115.7.0 When I open an email from another gmail account with image attachment, it only shows the file name. Example 'image.jpg'… (funda kabanzi)
I receive gmail using Thunderbird version 115.7.0
When I open an email from another gmail account with image attachment, it only shows the file name. Example 'image.jpg' but not download or open option for the file.
Problem solved when I changed Message Body from 'Original HTML' to 'Plain Text'.
It's this normal? Is it a problem caused by the sender? Or it there a better way I can handle this at my end?
Sometimes I can see folders. Other times I can't. And I can't figure out how to change the view. When I search help I get 1384 hits. Clicking on folders in Thunderbird do… (funda kabanzi)
Sometimes I can see folders. Other times I can't. And I can't figure out how to change the view. When I search help I get 1384 hits. Clicking on folders in Thunderbird does nothing.
Dear Mozilla Team, using Thunderbird I encountered a new problem regarding my Microsoft live.com account. I've had problems logging in, I'm asked for a new password. I'… (funda kabanzi)
Dear Mozilla Team,
using Thunderbird I encountered a new problem regarding my Microsoft live.com account. I've had problems logging in, I'm asked for a new password. I've seen that this here seems to be the problem (and solution): https://support.mozilla.org/en-US/kb/microsoft-oauth-authentication-and-thunderbird-202
I've then tried to follow the directions given in the article. However, I cannot change my outgoing smtp settings to Oauth2 (it only gives the options "password, normal", "password, encrypted", "Kerberos", "NTLM" and "No Authentification").
Now, I am not asked for new login data, but my mails do not appear either. It appears, that there is now no successful connection to the server (it keeps getting stuck contacting the host and sending login data; see image attached - in german).
Is there any fix to this?
Best Niklas
Will not open after changing passwords in accounts
Hi, Since about two days ago firefox on both my PC and laptop has been trying to connect to a random website called ponf.linkedin.com that I have no idea where it came o… (funda kabanzi)
Hi,
Since about two days ago firefox on both my PC and laptop has been trying to connect to a random website called ponf.linkedin.com that I have no idea where it came out of.
I have no clue why this was but I reset both browsers on both devices + reinstalled windows 11 on my main PC and it only continues happening on my PC now, i've managed to replicate the behaviour by resetting the browser and everytime that happens firefox attempts to connect to this website even though bitdefender blocks it and nothing comes up, no popup or anything as if its just in the shadows.
Does anyone have any idea why this would be and what I should do? any help is appreciated thanks.
Netflix will not play in Firefox on windows 11. Any help is appreciated. First error message is a connectivity issue, but Netflix will play in other browsers. Then second… (funda kabanzi)
Netflix will not play in Firefox on windows 11. Any help is appreciated. First error message is a connectivity issue, but Netflix will play in other browsers. Then second error message is F7111-1957-205002. I have followed both suggestions, with no luck. Anyone that has had this issue or knows how to fix it, please let me know. Thanks.
Several emails in my Earthlink Webmail inbox online received between 6:03 am and 9:21 am PST 2/21/2022 did not download to Thunderbird when I clicked on "Get Messages." … (funda kabanzi)
Several emails in my Earthlink Webmail inbox online received between 6:03 am and 9:21 am PST 2/21/2022 did not download to Thunderbird when I clicked on "Get Messages." They came from 2 different sources from which I have received and downloaded email many times before with no difficulty. Since then I have received and downloaded emails from these same sources, so there appears to be no ongoing problem. Earthlink tech support said there was nothing wrong on their end and my version of Thunderbird is current. This has never happened before in many years of both Earthlink service and using Thunderbird. ??? (No jargon, please, as my tech knowledge is seat of my pants.)
I'm a new Thunderbird user with v115.7.0 on Windows 11, using a mailbox.org account. Under Account Settings/Copies and Folders/Message Archives/Keep message archives in:… (funda kabanzi)
I'm a new Thunderbird user with v115.7.0 on Windows 11, using a mailbox.org account.
Under Account Settings/Copies and Folders/Message Archives/Keep message archives in: I am using the Other setting to point to Local Folders/mailbox.org Archive. Under Archive Options I am using Single Folder and "Keep existing folder structure of archived messages". The example in the options window shows an Archives folder with an Inbox subfolder. However, this doesn't happen.
Messages archived from my Inbox go to Local Folders/mailbox.org Archive/ Messages archived from Inbox/Subfolder go to Local Folders/mailbox.org Archive/Subfolder Messages archived from my Sent items go to Local Folders/mailbox.org Archive/Sent
So of the above, only Sent items go to the correct folder. For anything from the Inbox, the Inbox folder itself is not replicated as per the example on the options page. Can this be corrected?
Many months ago, I created another context for the file explorer drop down to “Send To” Thunderbird, vs the Windows mail client. Recently, this function stopped working,… (funda kabanzi)
Many months ago, I created another context for the file explorer drop down to “Send To” Thunderbird, vs the Windows mail client.
Recently, this function stopped working, meaning TB does not open a new message and of course nothing is “attached”.
I detected the addition to the context drop down and then added it (again).
No luck.
My Thunderbird Version = 115.8.0
When I click on a file and open the File Explorer Send To drop down, Windows “shows Thunderbird in the context (my addition) but as noted I don’t have a new message with the file attached.
Correct I’m not using the Mail Client.
Yes, in APPS, Thunderbird is listed as the email client.
Thoughts?
My Thunderbird(115.8.0) and Windows 11 just don't get along. My Thunderbird has a Menu button in the top right that's just there for it does nothing when I click or righ… (funda kabanzi)
My Thunderbird(115.8.0) and Windows 11 just don't get along. My Thunderbird has a Menu button in the top right that's just there for it does nothing when I click or right click so I guess no add-ons, calendar, etc. If I hover over it I see "Display the Thunderbird Menu" and that's it. When I open the program it doesn't go to my inbox, it goes to a page that I have to click on "Read Messages" to get to my inbox and in prior versions and I had Windows 10 this never happened. When I go to buttons on the left and click on "Help" and then "About Thunderbird" to check on updates I always get "Unable to check for updates due to internal error" and oh yeah now in Thunderbird I can't copy and paste, I can highlight but when I right click....nothing.
I've tried uninstalling and reinstalling and even tried removing hidden folders, but as of now nothing has worked. I don't know what to think and I'm truly at a loss and it sure looks like I have to find another email program because right now Thunderbird just ain't working. I've been using this program I believe for over 20 years with really zero problems but my luck has apparently run out. Sorry for the mini series. lol
What would cause messages in the inbox to be deleted within less than 12 hours after being read and being placed in the trash folder without a command to do so?
I have had this spam pop up 2 times when I was on Facebook through Firefox through DuckDuckGo. Could someone confirm that this is spam and how to fix it? Also, I would l… (funda kabanzi)
I have had this spam pop up 2 times when I was on Facebook through Firefox through DuckDuckGo. Could someone confirm that this is spam and how to fix it? Also, I would like to report it to Firefox and I can't find how to do that either. Thank you
I can't print an email. The whole screen prints and is too small to read. I read previous answers to use the drop down menu and select print, but then I get window that… (funda kabanzi)
I can't print an email. The whole screen prints and is too small to read.
I read previous answers to use the drop down menu and select print, but then I get window that says I have a blocking the print. I don't have an active blocker. I do have malwarebytes. Never had any trouble printing on chrome or safari.
Da tre giorni non riesco a scaricare le mail
I use the Android beta version of Firefox to open the website as shown in the picture. I've turned on the option Ask me when opening links with external apps in settings… (funda kabanzi)
I use the Android beta version of Firefox to open the website as shown in the picture. I've turned on the option Ask me when opening links with external apps in settings. When I clicked the Open APP button in the upper right corner, there was no pop-up window asking me whether to open Quark Browser as expected, but it was downloaded directly. However, when I visit some other websites such as Zhihu, the correct pop-up window appears. What is the problem?