Форум сообщества Thunderbird

Hi all :).... thanks in advance for reading my issue. My partner is in Austria, she is not PC/tech competent (me neither to be clear!)... I have been helping with quick assist)...thunderbird suddenly blocked sending messages and refused to accept the password (it works elsewhere and is correct)... first issue seemed to think we are spammers. somehow we got round that but now sending just hangs and does not complete. She has hundreds and hundreds of emails in message pane and in a long list of folders. Her provider is BT mail (IMAP/SMTP). Send & receive via gmail on the same laptop works ok. She has painstakingly set up thunderbird to work in a way she can understand and she prefers it to BT webmail (which also works ok - send/receive). Saved passwords in Thunderbird are correct and we triple checked all the account & server settings and even tried variants/ports etc) Question: if we delete the thunderbird from the laptop (uninstall in programmes and features) and redownload from mozilla... will the messages and folders repopulate by default or when a new email server is added..... i seem to remember that somehow the new download sort of remembers the old programme (we tried something like that in the past).... her stache of folders and messages is critical. windows 10 and Bitdefender antivirus. Any thoughts or guidance much appreciated regards steve

I am a multi-decade Thunderbird user, and this is a problem new to the most recent release.

I have some large MBOX local folders (to be clear, a single file in the disk directory), and there are never deletions, only additions. Every week or so, there is one local folder (that only gets additions) which TBird takes 15 minutes to try to compact, and fails creating a new local folder (with -1 appended to the name), which has only a portion of the content of the original folder (that original folder appears to be untouched).

I have already upped the compaction threshold to 100MB, but it recurs nonetheless.

Is there any fix to this?

Thanks Jonathan

Through some kind of crazy error, I downloaded 300,000 old emails, going back 7 years, to Thunderbird! Obviously the whole system is moving really slow and the normal "select and delete" method will take forever. Is there some kind of back-door way to do this, possibly from within Windows File Explorer? Or am I stuck doing it the regular way? I only need to keep the current year. Thanks in advance.

I know this subject has been started but a cursory look through the forum shows no fix. I am pretty clueless with anything technical as far as computers go but I can look through menu's on the task bar and see or find nothing relating to spell checking or dictionaries or where to find them. I run the spell checker after each email and it never shows spelling mistakes but just reading back through a few recent emails I rushed out I am seeing countless spelling mistakes the spell checker did not pick up. I don't know what to do. Any pointers would be appreciated. Thank you. Whilst I am here. I regularly get an error box from Mozilla apologising for thunderbird crashing and to file a report when in fact it did not crash and I had shut it down as normal. UK resident.

Hi everyone! I completely cleaned TB (using BCUninstaller) from the system, reinstalled, and it still won't add a google account. Tried different ways several times. I never had any problems with gmail in previous versions. Been using it for over a decade.

Before that, I had the previous TB. I decided to uninstall it completely and put the latest clean version to set everything up again.

I recently updated to Ubuntu 24.04.1 LTS and Thunderbird also updated (?) and now seems to be loaded under /snap. I have therefore lost connections to my signatures and it seems slower. What do I need to do?

after replying to an email, I checked the Sent folder and cannot see my reply text only garbage (see reply.jpg) strangely, the reply text is correctly visible (and readable!) on my iPhone (using icloud account in Thunderbird)

PS if that may help, email was replied to before latest update 128.2.3esr

My Thunderbird intallation has stopped my laptop functioning. Just chewing up space. I have unticked the save on local computer button, but need to purge old emails to clear up space. Any help gratefully recieved

I installed Nebula and when it installed all the emails in the From field now display as:

Name, abc.123@mymail

instead of simply Name (eg Jon Doerr) as it was before. This happens in all folders. See attached image.

I cannot find how to revert to the format I had, this makes it impossible for me to use TB .... thanks a lot!

Marco

I have send several emails to a contact that is returned as not deliverable from postmaster@outlook.com. The notification email shows that the address has been changed for an old email address even though the correct email address is shown in the details. The change appears to have been by outlook.com Correct emails is via slingshot and the old email is outlook.

Details below

Delivery has failed to these recipients or groups:

colinandchris@outlook.com A communication failure occurred during the delivery of this message. Please try to resend the message later. If the problem continues, contact your email admin.

Diagnostic information for administrators:

Generating server: MW4PR18MB5184.namprd18.prod.outlook.com

colinandchris@outlook.com Remote server returned '550 5.5.0 Requested action not taken: mailbox unavailable.'

Original message headers:

Received: from CY5PR18CA0016.namprd18.prod.outlook.com (2603:10b6:930:5::16)

by MW4PR18MB5184.namprd18.prod.outlook.com (2603:10b6:303:1b7::12) with
Microsoft SMTP Server (version=TLS1_2,
cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.7982.27; Thu, 26 Sep
2024 05:01:28 +0000

Received: from CY4PEPF0000E9D1.namprd03.prod.outlook.com

(2603:10b6:930:5:cafe::54) by CY5PR18CA0016.outlook.office365.com
(2603:10b6:930:5::16) with Microsoft SMTP Server (version=TLS1_2,
cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.8005.17 via Frontend
Transport; Thu, 26 Sep 2024 05:01:27 +0000

Authentication-Results: spf=softfail (sender IP is 202.180.64.247)

smtp.mailfrom=xtra.co.nz; dkim=pass (signature was verified)
header.d=xtra.co.nz;dmarc=pass action=none header.from=xtra.co.nz;

Received-SPF: SoftFail (protection.outlook.com: domain of transitioning

xtra.co.nz discourages use of 202.180.64.247 as permitted sender)

Received: from mda-1.slingshot.co.nz (202.180.64.247) by

CY4PEPF0000E9D1.mail.protection.outlook.com (10.167.241.136) with Microsoft
SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id
15.20.8005.15 via Frontend Transport; Thu, 26 Sep 2024 05:01:27 +0000

X-IncomingTopHeaderMarker: OriginalChecksum:DB1FE006DE5E96A6CB1C51C2D72775AD0076153BEBCC1BDA65711D9E9A6537A9;UpperCasedChecksum:778EF9C4E589FF5ECCD72A8C27E3459E0E6D41342EEF1A70760B01A53E8BF679;SizeAsReceived:4099;Count:27 Received: from [10.253.37.119] (port=46199 helo=spamtitan-3.slingshot.co.nz) by mda-1.slingshot.co.nz with esmtp (Exim 4.90_1) (envelope-from <tony.perkins@xtra.co.nz>) id 1stgd4-0007OD-Dc for colin.selfe@slingshot.co.nz; Thu, 26 Sep 2024 17:01:26 +1200 Received: from localhost (localhost [127.0.0.1]) by spamtitan-3.slingshot.co.nz (Postfix) with ESMTP id 502359913BE for <colin.selfe@slingshot.co.nz>; Thu, 26 Sep 2024 17:02:19 +1200 (NZST) X-Virus-Scanned: by SpamTitan at slingshot.co.nz X-Spam-Flag: NO X-Spam-Score: -2.198 X-Spam-Level: X-Spam-Status: No, score=-2.198 tagged_above=-999 required=5.3 tests=[BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, FREEMAIL_FROM=0.001, RCVD_IN_VALIDITY_CERTIFIED_BLOCKED=0.001, RCVD_IN_VALIDITY_RPBL_BLOCKED=0.001, SPF_HELO_PASS=-0.001, SPF_PASS=-0.001, ST_P0F_Linux=-0.1, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no Received: from spamtitan-3.slingshot.co.nz (localhost [127.0.0.1]) by spamtitan-3.slingshot.co.nz (Postfix) with ESMTP id AFC029913A5 for <colin.selfe@slingshot.co.nz>; Thu, 26 Sep 2024 17:02:07 +1200 (NZST) Authentication-Results-Original: spamtitan-3.slingshot.co.nz; dkim=pass

(1024-bit rsa key sha256) header.d=xtra.co.nz          header.i=@xtra.co.nz
header.b=T4OlzVWQ header.a=rsa-sha256          header.s=alpha x-bits=1024;
       spf=pass smtp.mailfrom=tony.perkins@xtra.co.nz
         smtp.helo=out2305.xtra.co.nz

Received-SPF: pass

       (xtra.co.nz: 210.55.143.52 is authorized to use 'tony.perkins@xtra.co.nz' in 'mfrom' identity (mechanism 'ip4:210.55.143.48/29' matched))
       receiver=spamtitan-3.slingshot.co.nz;
       identity=mailfrom;
       envelope-from="tony.perkins@xtra.co.nz";
       helo=out2305.xtra.co.nz;
       client-ip=210.55.143.52

Received: from out2305.xtra.co.nz (out2305.xtra.co.nz [210.55.143.52]) by spamtitan-3.slingshot.co.nz (Postfix) with ESMTPS id A225A9913AB for <colin.selfe@slingshot.co.nz>; Thu, 26 Sep 2024 17:02:07 +1200 (NZST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=xtra.co.nz; s=alpha; t=1727326874; bh=H78nCiYDtFwdgxiHc6OD0p8AlpIcxsbZIcjSHe2zddg=; h=Message-ID:Date:To:From:Subject; b=T4OlzVWQAbA91+M4Q7Wz9amCL40k60E+h3rzIHHdA9AUB1nJyj/779fmlfB9h55jF DV3I0p9zHK+Qpx2H+VdDjBm1U6t4OtKvBu55r0+/HLuHPIf5PmMwkUwEP4ikLOQSsf 1EUcZcB4Hexjl8bvT7nHB/1+SbaEennpjJ/vvQow= SMX-Results: classifications=clean;dmarc=none;spf=softfail SMX-S1C: gggruggvucftvghtrhhoucdtuddrgeeftddrvddtiedgledtucetufdoteggodetrfdotffvucfrrh hofhhilhgvmecuuffoigenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnhhtshcu lddquddttddmnecujfgurhepkfffgggfvffhufgtgfesthejredttddvjeenucfhrhhomhepvfhonh ihucfrvghrkhhinhhsuceothhonhihrdhpvghrkhhinhhsseigthhrrgdrtghordhniieqnecuggft rfgrthhtvghrnhepheegueelleehudeiueegtdeigfegvdefvdfgheeujeeivedtjeehkeeivdehtd dunecukfhppedvvddvrdduheefrddvhedvrddukeenucevlhhushhtvghrufhiiigvpedtnecurfgr rhgrmhepihhnvghtpedvvddvrdduheefrddvhedvrddukedpmhgrihhlfhhrohhmpehtohhnhidrph gvrhhkihhnshesgihtrhgrrdgtohdrnhiipdhnsggprhgtphhtthhopedupdhrtghpthhtoheptgho lhhinhdrshgvlhhfvgesshhlihhnghhshhhothdrtghordhniidpmhhouggvpehsmhhtphhouhhtpd hsphhfpehsohhfthhfrghilhdphhgvlhhopegludelvddrudeikedruddrjeefngdpoffvtefjohhs thepmhhtrgdvfedtuddptehuthhhpghushgvrhepthhonhihrdhpvghrkhhinhhsseigthhrrgdrtg hordhniidprhgvvhfkrfepvddvvddqudehfedqvdehvddqudekqdhfihgsrhgvrdhsphgrrhhksggs rdgtohdrnhii SMX-S1V: clean SMX-S1S: -100 Received: from [222.153.252.18] by send.xtra.co.nz with ESMTP (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)) id 66F4EA99-AF8304CF@mta2301.omr; Thu, 26 Sep 2024 05:01:14 +0000 Message-ID: <13898879-8cdf-4c48-8c41-d73b904b0218@xtra.co.nz> Date: Thu, 26 Sep 2024 17:01:14 +1200 MIME-Version: 1.0 User-Agent: Mozilla Thunderbird To: Colin Selfe <colin.selfe@slingshot.co.nz> Content-Language: en-NZ From: Tony Perkins <tony.perkins@xtra.co.nz> Subject: JPproductions Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit X-IncomingHeaderCount: 27 Return-Path: tony.perkins@xtra.co.nz X-EOPAttributedMessage: 0 X-EOPTenantAttributedMessage: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa:0 X-MS-PublicTrafficType: Email X-MS-TrafficTypeDiagnostic: CY4PEPF0000E9D1:EE_|MW4PR18MB5184:EE_ X-MS-Office365-Filtering-Correlation-Id: b990f7fa-306a-45fb-ecf3-08dcdde84742 X-MS-Exchange-EOPDirect: true X-Sender-IP: 202.180.64.247 X-SID-PRA: TONY.PERKINS@XTRA.CO.NZ X-SID-Result: PASS X-Microsoft-Antispam: BCL:0;ARA:1444111002|32000799015|461199028|1370799030|1380799030|1360799030|3412199025|440099028; X-Microsoft-Antispam-Message-Info: 2kKnXLplXHmjbfleeJ/bK1BAdohb7k3RZrkD0GaO7u8wESFqkG4fwKjlX6uyfHCaZnsqVO3BYPdLZL3mJRxCre+vhNmMStCGb9VFiwx09RfMMqOHrnXIrRxGOWEZroW+yVf83DDov9XR48k/GRw1s9/ewkNPL7Oq0dwn3iZOAYnCKk9BRf3eQcil8Nv57Gc5pnETDNteSqVa7/ZN4r4VkcrTbuSLKh8C/Aki7xli3+rbwlO64ZIjiGDR1j28FlNdR8oqjcark/6hpyxU3xnJmBSJ8IcPsZBwnxCB3x9gq6bVB4+KVvyMjM96qIeXTdhbtOU1pYWEuz3/49gpfih0RyGrlS8fshI6Ep3Ccyy9C8tPHdzDyeRLwDe6+izQ1oRNZfUMK+wXUHNLe9o5ljWS+15q2PVUynbMcXK3OWo1c3HkqBqqEqDncu/dL05BlWesHvNfT7/5dnYLLPJPfWUmGcoY7NfxcapjhgAvnLxmq3HEz7UornCtKJ643QmpBMOz2dk4h/xjRBWaoRGjCQL8oago5+GapirJNm1VVHgF6fkjguu5Tjw2QAGm1XRzWMUxQ0kvw5wSfGiixthUQoj3OIGpyWwyqnRqb7swBz64mWYQl0SeOKE7JSGYRZjoo72welRQvGZQahqDWOi+I2jJ7WP7mzNG0CJNk6PG29EwC8FBhG5w9ywMm5la01BvazaJz9+AHQ4mW09UXsYf3cXxPseTiivUDkgS/NauxASoFM7NGmE7BG41ypkIoQ8XuX2CZqkf0xtkK3KudT/j030HAOs51m7xY7oE5GrEuBtj+iLzKRjAcSrQtkbG6DjyTLGljOhAFkmvBvmURvrlvSFE8g==

Reporting-MTA: dns;MW4PR18MB5184.namprd18.prod.outlook.com Received-From-MTA: dns;mda-1.slingshot.co.nz Arrival-Date: Thu, 26 Sep 2024 05:01:28 +0000

Final-Recipient: rfc822;colinandchris@outlook.com Action: failed Status: 5.5.0 Diagnostic-Code: smtp;550 5.5.0 Requested action not taken: mailbox unavailable.

Hi,

One of my mailboxes has more than 40GB is on an IMAP server, and all thunderbird runs very slow because of it. I tried to clean this mailbox but it keeps downloading deleted messages. Please help :(

Regards B

I had to change my Google password. Immediately after the change on sept 14th, I was and am still unable to send or receive mails, receiving the message : "Authentication failed when connecting to imap.gmail.com server". Giving my permission/consent to allow Mozilla accessing my Google account is useless, because it is repetetively asking me to give my password in " imap.gmail.com" . I don't know how to do that : in the settings, there is no place to write my password. Do you have a solution ? Many thanks

On Tuesday, September 24, 2024, Thunderbird was auto-updated on my computer. Shortly after that, I tried to start the tax preparation program I use for preparing tax returns for my clients. I am a CPA and tax preparer. The tax prep program is called "ATX" and is a product sold by Wolters-Klewer (aka CCH), and is unrelated to Thunderbird. I can no longer access my ATX tax prep program.

When I try, I get this message: "The program has encountered an unexpected error and needs to close." I have tried multiple times, and get the same error message every time. I also get that message when I try to start ATX for previous tax years. I am sure it is the Thunderbird update that is causing this, as I have made no other changes to my computer, programs, hardware, or anything else. The ATX program worked just fine up until yesterday.

I badly need that ATX program. Please help ASAP. If someone wants to call me, my number is (775) 747-4666.

Finally, the error message I get when I try to start the ATX program has a link that says "Show details." When I click that, I get a long list of gobbledegook, but one line may be relevant here. It says: "Unable to connect to the remote server ---> System.Net.Sockets.SocketException: No connection could be made because the target machine actively refused it "

I have over fifty tax return to prepare before the extended deadline of October 15th, so I desperately need to be able to open my tax prep program. I am almost certain the Thunderbird update caused this, so please help fix this right away. Thank you.

Richard Schiveley, CPA (Reno, Nevada)

Thunderbird gobbles up too much of my SSD space!

How can I prevent this from happening?

I'm using Thunderbird 128.2.3esr (64-bit) Safari browser Version 18.0 (19619.1.26.111.10, 19619) Macbook Air M2 15" running OS 14.7

See attached screenshot

For the past few days I have intermittently had a problem sending email. I get email from Spectrum, my ISP. When I try to send I get this message: Sending of the message failed. An error occurred while sending mail: Outgoing server (SMTP) error. The server responded: p-impout007.msg.pkvw.co.charter.net cmsmtp 173.211.127.45 blocked. Please see https://www.spectrum.net/support/internet/understanding-email-error-codes for more information. AUP#Out-1130.

When I go to the indicated website and look up error 1130, this is what I get: The IP address you’re trying to connect from has an issue with the Domain Name System. Spectrum requires a full circle DNS for emails to be allowed through. Verify the IP you’re connecting from, and check the IP address to ensure a reverse DNS entry exists for the IP. If the IP address is a Spectrum-provided email address, contact us.

Note my email address is not Spectrum provided.

Microsoft outlook warned that I will no longer be able to use thunderbird after Sept 16th unless I use Oauth. I've tried changing settings to allow Oauth, but it's not listed as an option fot outgoing mail. Is this because I'm running windows 7? Is there any way around this, I want to keep win 7?

Thanks...