Форум поддержки Все продукты

Hi,

Since about two days ago firefox on both my PC and laptop has been trying to connect to a random website called ponf.linkedin.com that I have no idea where it came out of.

I have no clue why this was but I reset both browsers on both devices + reinstalled windows 11 on my main PC and it only continues happening on my PC now, i've managed to replicate the behaviour by resetting the browser and everytime that happens firefox attempts to connect to this website even though bitdefender blocks it and nothing comes up, no popup or anything as if its just in the shadows.

Does anyone have any idea why this would be and what I should do? any help is appreciated thanks.

My Firefox browser is broken, I can open Firefox but I can not do anything it will not respond, clicking anywhere prompts a "Firefox is not responding" error message, I was able to "refresh" Firefox once with zero results, I have tried uninstalling Firefox yet it will not uninstall the uninstallation window comes up yet no matter how long it sits open nothing happens, I have tried reinstalling Firefox with no results, the installation freezes just before completing and says "Firefox could not be installed". I have been using Firefox as my primary browser for a long time but I am unable to use it in any way now. All other browsers are working fine no issues but I do prefer Firefox and would like to continue to do so. What do you suggest?

I'm a new Thunderbird user with v115.7.0 on Windows 11, using a mailbox.org account.

Under Account Settings/Copies and Folders/Message Archives/Keep message archives in: I am using the Other setting to point to Local Folders/mailbox.org Archive. Under Archive Options I am using Single Folder and "Keep existing folder structure of archived messages". The example in the options window shows an Archives folder with an Inbox subfolder. However, this doesn't happen.

Messages archived from my Inbox go to Local Folders/mailbox.org Archive/ Messages archived from Inbox/Subfolder go to Local Folders/mailbox.org Archive/Subfolder Messages archived from my Sent items go to Local Folders/mailbox.org Archive/Sent

So of the above, only Sent items go to the correct folder. For anything from the Inbox, the Inbox folder itself is not replicated as per the example on the options page. Can this be corrected?

I have a bunch of content in my Local Folders: Junk mailbox but none of it is showing up in Thunderbird. The Properties for the folder shows "Number of messages: 0", "Size on disk: 3.4 MB". I've tried the "Repair Folder" button but it makes no difference. The folder views as empty in Thunderbird.

Not sure when this started happening because I don't recall having this problem in the past. The folder permissions are the same as all the other mailboxes:

ls -l Junk* -rwx------@ 1 uid staff 3578520 23 Feb 08:51 Junk* -rw-r--r--@ 1 uid staff 3289 24 Feb 12:39 Junk.msf

Suggestions welcome.

In regular web pages, I'm able to hover over an URL / picture w/ URL behind it, etc.... It shows up on the status bar at the bottom of the page (that's what it used to be called). Sometimes I can't.

Somewhere around the same time as I started noticing this, I had just upgraded to a Win11 computer. So, when I try to hover over a suspicious link, I get nothing!

Is there code these people can put in that shields them from hover? So, we can't see what we're getting into? If so, then I presume if I can't hover, don't click... Right?

TIA

I can't print an email. The whole screen prints and is too small to read.

I read previous answers to use the drop down menu and select print, but then I get window that says I have a blocking the print. I don't have an active blocker. I do have malwarebytes. Never had any trouble printing on chrome or safari.

Recently my browser stopped opening in full screen. It opens in a little box that is usually partially off screen. I have not changed any settings and do not understand why this is happening. I maximize the window which usually has to be done twice (meaning I hit the maximize window twice to get it to go completely back to full screen). I have also tried dragging the corners of the window to maximum size, but the following day it will go back to not opening in full screen. If someone could help me with this, I would really appreciate it.

1.Running Thunderbird 115.6.0 64 bit on Windows 10. 2.Using Microsoft Defender as AntiVirus and I set Thunderbird profile folder to be excluded from AV. 3.Getting emails from a single Earthlink pop server account. Problem: When clicking Get Messages it works great except yesterday there was one single email on the pop server that would not download properly. It prevented all subsequent messages from downloading. It is a valid email and is not spam. When I searched for the message, it showed multiple times (about 50) in the Thunderbird Inbox. When I deleted the email from the pop server, everything works again. What is there about this messages that causes it to lockup the get message process? Thanks for your help, John

Here is the problem email header: Authentication-Results:mail142c38.carrierzone.com; spf=pass smtp.mailfrom=bankhometown.com Content-Transfer-Encoding:8bit Content-Type:text/plain; charset=us-ascii Date:16 Feb 2024 23:37:56 -0500 Dmarc-Filter:OpenDMARC Filter v1.4.1 mail142c38.carrierzone.com 41H4bxPb013175 From:PPDONOTREPLY@bankhometown.com Message-ID:<3w65bxfyau-1@ppt-gw2.cocci.com> Mime-Version:1.0 Received:from ext-smtp.cocci.com (mail-ext01.cocci.com [204.60.84.37]) by mail142c38.carrierzone.com (8.14.9/8.13.1) with ESMTP id 41H4bxPb013175 for <lisa@bcscompany.com>; Fri, 16 Feb 2024 23:38:02 -0500 Received-Spf:pass (mail142c38.carrierzone.com: domain of ppdonotreply@bankhometown.com designates 204.60.84.37 as permitted sender) receiver=mail142c38.carrierzone.com; client-ip=204.60.84.37; helo=ext-smtp.cocci.com; envelope-from=ppdonotreply@bankhometown.com; x-software=spfmilter 2.001 http://www.acme.com/software/spfmilter/ with libspf2-1.2.10; Return-Path:<ppdonotreply@bankhometown.com> Subject:Positive Pay System Notifications To:lisa@bcscompany.com X-Cocc-Mailscanner:Not scanned: please contact your Internet E-Mail Service Provider for details X-Cocc-Mailscanner-Information:Please contact the ISP for more information X-Cocc-Msgid:DB8A556B4.A1271 X-Da-Pass:W0T0 X-Envelope-From:ppdonotreply@bankhometown.com X-Mime-Autoconverted:from quoted-printable to 8bit by mail142c38.carrierzone.com id 41H4bxPb013175 X-Origin-Country:US X-Spam-Flag:NO X-Vade-Spamcause:gggruggvucftvghtrhhoucdtuddrgedvledrvdefgdejvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffuvffqrffktedpgffpggdqveefkeenuceurghilhhouhhtmecufedtudenucenucfjughrpegghffvfffutgfgkfesthhqredttddtvdenucfhrhhomheprffrfffqpffqvfftgffrnfgjsegsrghnkhhhohhmvghtohifnhdrtghomhenucggtffrrghtthgvrhhnpeekjeehieetvefftedvheekhedvudetffeufeehveejjeetvdfhteegffevleduudenucfkphepvddtgedriedtrdekgedrfeejnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtgedriedtrdekgedrfeejpdhhvghlohepvgigthdqshhmthhprdgtohgttghirdgtohhmpdhmrghilhhfrhhomhepphhpughonhhothhrvghplhihsegsrghnkhhhohhmvghtohifnhdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehlihhsrgessggtshgtohhmphgrnhihrdgtohhm X-Vade-Spamscore:0 X-Vade-Spamstate:clean X-Whl:LR

I've been trying to reply to moderator "Phil" who requested information regarding Firefox crashing while on Youtube. When I press "Post reply" all I get is an error message:

An Error Occurred

Oh, no! It looks like an unexpected error occurred. We've already notified the site administrators. Please try again now, or in a few minutes.

It's important "Phil" gets my message as others may be affected my possible Youtube shenanigans. If possible, can you forward this message to "Phil": Unfortunately there are only two reports generated during the problems with Youtube:

bp-91f496a8-971c-4a87-a642-011d10240220 bp-7d820f6c-dcf9-4cef-bb60-1a9f50240217

The problem caused my system to stop responding forcing me to power cycle to clear my PC, so no reports could be generated. Hopefully these two will show what the problem is. In the meantime, can you check the reply system to make certain it's working properly?

The inbox listings move once an email is selected. This began upon an upgrade to Debian 11 which included an upgrade to Thunderbird. I had the same issue with an upgrade to Antix 21 recently. That issue was resolved with another upgrade to Thunderbird about a week later.

I receive gmail using Thunderbird version 115.7.0

When I open an email from another gmail account with image attachment, it only shows the file name. Example 'image.jpg' but not download or open option for the file.

Problem solved when I changed Message Body from 'Original HTML' to 'Plain Text'.

It's this normal? Is it a problem caused by the sender? Or it there a better way I can handle this at my end?

I need to run speech recognition in Firefox (OS solutions are not suitable in my case), but I can't get it to work. I've tried following these instructions in Nightly, Dev and regular version, but they all end with a network error. I also asked my friends to check and they had the same thing happen. Do I need to follow the steps to run offline or is the problem much deeper?

Firefox Dev 124.0b2 (64-bit) Firefox Nightly 125.0a1 (2024-02-22) (64-bit)

Sometimes I can see folders. Other times I can't. And I can't figure out how to change the view. When I search help I get 1384 hits. Clicking on folders in Thunderbird does nothing.